KEGG   Clostridium acidurici: Curi_c10900Help
Entry
Curi_c10900       CDS       T02255                                 

Gene name
tpiA
Definition
triosephosphate isomerase TpiA (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cad  Clostridium acidurici
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Curi_c10900 (tpiA)
   01230 Biosynthesis of amino acids
    Curi_c10900 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Curi_c10900 (tpiA)
   00051 Fructose and mannose metabolism
    Curi_c10900 (tpiA)
   00562 Inositol phosphate metabolism
    Curi_c10900 (tpiA)
Enzymes [BR:cad01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Curi_c10900 (tpiA)
Exosome [BR:cad04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Curi_c10900 (tpiA)
  Exosomal proteins of bladder cancer cells
   Curi_c10900 (tpiA)
  Exosomal proteins of melanoma cells
   Curi_c10900 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1172054..1172800
Genome map
AA seq 248 aa AA seqDB search
MRKPFIAGNWKMHKTINESVELVREIKAKIKDSDVEVAVCVPFTSLNEVKKEIQETNIKL
GAQNMHWEESGAFTGEVSGAMLKEIGVDYVILGHSERRQYFGETDETVNKKIKKALEYNI
NPIFCVGETLEQRESGIDREIIKGQVIKGLEDISSEDLERIVIAYEPIWAIGTGKTASKE
DANSMISFIRETLKEKYDSEVSQKVRIQYGGSVKPDNVSEIMSQSDIDGALVGGASLKSD
DFLALVQF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaagccttttatcgcaggtaactggaagatgcacaagacaataaatgagtctgta
gaattagttagagaaataaaagctaaaataaaagactctgatgttgaagtagcagtttgt
gttccatttacttctttaaatgaagtgaaaaaagaaatacaagagacaaatataaagctt
ggtgctcaaaatatgcattgggaagaaagtggtgcatttacaggagaagtatcaggagct
atgttaaaggaaataggtgtagactatgttattctaggccactctgaaagaagacagtat
ttcggagaaacagatgaaacagtaaataagaaaataaaaaaagcgctagaatataatata
aatcctatattctgtgtaggagagacactagaacaaagagaatctggcattgatagagaa
ataattaaaggccaagtaataaaaggattagaagatatatctagtgaagatttagaaaga
atagttatagcttatgagccaatatgggctataggaacaggaaaaacagcgtctaaggaa
gatgcaaatagtatgatttcattcattagagaaacattaaaagaaaaatatgactcagaa
gtttctcaaaaagttagaatacaatatggtggaagtgttaagccagacaatgtaagtgaa
ataatgagtcaatcagatatagatggtgcattagtaggtggagctagcttaaagtctgat
gatttcttagcacttgttcagttttaa

DBGET integrated database retrieval system