KEGG   Clostridium acidurici: Curi_c11860Help
Entry
Curi_c11860       CDS       T02255                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cad  Clostridium acidurici
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cad01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cad00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1285970..1286767
Genome map
AA seq 265 aa AA seqDB search
MDVRSKLKQAEKIVIKVGTSSLTYSNGKLNLERIERLARVLSDLNNQDKKIVLVSSGAIG
VGVERLGLNRTEVTLPEKQASASVGQAILMKIYQKFFEEYNTPVSQILLTKDVMDGGIRK
ENAQNTFNTLLDMGVIPIVNENDTISTFEIEFGDNDTLSATVASLVGADLLILLTDIDGL
FTADPRKDKNAEIISVVEEINEEIDSAADGAGSKLGTGGMVTKISAAKICCSYGIDTVIA
NGEDPKIIYDILDAKEIGTLFLSGK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcagaagcaaactaaaacaagctgaaaaaatcgtaattaaagtaggaacttct
agcttaacttactcaaatggaaagctgaacttagagcgtatagaaaggttagctagagta
ttgtctgatttaaataatcaagataaaaaaatagtactagtttcatcaggggctatagga
gttggagtagaaagactaggtcttaatagaacagaggttacattaccagaaaagcaagcc
tcagcttctgtaggtcaagcgatccttatgaaaatataccaaaagttctttgaagaatac
aacactccagtatcacagatactcttaactaaagatgttatggatggtggcataagaaaa
gagaacgcacaaaatacatttaatacgcttctggatatgggagtaattccaatagtaaat
gaaaatgatactatatcaacttttgagatagagtttggagataacgatacactttcagca
acagtagcttctttagtaggtgctgatttacttatactacttacagatatagatggacta
tttacagcagatcctagaaaagataaaaatgcagaaattatatctgtagtggaagaaata
aatgaggaaatagatagtgcagctgatggagctggaagtaaactaggaacgggtggaatg
gttactaagatatcagcagcaaagatatgctgtagctatggaatagatactgtaatagca
aatggcgaagatcctaaaattatatacgatatattggatgcaaaagaaataggaacttta
tttttgtcaggtaaatag

DBGET integrated database retrieval system