KEGG   Clostridium acidurici: Curi_c12970Help
Entry
Curi_c12970       CDS       T02255                                 

Gene name
murE2
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase MurE (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cad  Clostridium acidurici
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cad00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Curi_c12970 (murE2)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Curi_c12970 (murE2)
Enzymes [BR:cad01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Curi_c12970 (murE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1398602..1400071
Genome map
AA seq 489 aa AA seqDB search
MKLNKLIDIENLLDVKGSLDIEITDVVYDSRKAKDGCVFVAIEGFKVDGHNFTEEVIKKG
ARAIIVQRDIDLEENITVIKVKSTRLALAEISSNFYQNPSSKLSLIGVTGTNAKTTTTYL
IQSILENVDKKTGIVGTIGNIINGKLFKTNNTTPESLELQKTFSNMVESKVDNCIMEVSS
HALDLNRVSYCDFETGIFTNLSVDHLDYHKTLENYLDAKIKLFYMTKKYNIINADDEYGK
RIIEKIKNIDTPLLTYGIENKCDIYATDIVYHLNGVEFRLNTPKGSIDIKMNIPGEFSVY
NALTAASCGYAYDLSLEDIKVGLESVKGVKGRFEVVDTDRDFVVIIDFAHTPDALEKALK
SIKEFAKRRLVVLFGAGGDRDNSKRATMGEIAGKYADFSIVTSDNPRSEDPTKIIEDILI
GTKKSTENYIAITDRKEAIKYAIENSKTNDIILLAGKGHETYTIIGEKTLPFDEREIVKE
ILAETELKR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaataagcttatcgatatagaaaatcttttggatgttaaaggttctctagac
atagaaataacagatgtagtatatgactctagaaaagcaaaggatgggtgtgtttttgta
gctatagaaggatttaaagtagatggtcacaactttactgaagaggtaataaagaaaggt
gctagagccataatcgttcagagagatatagacttagaagaaaacataacagtgataaaa
gttaaaagtacaagactagctttagcagagatatcttcaaacttttatcaaaacccttca
tctaaattaagtttaataggtgtgacaggaactaatgctaagacaacaacaacttattta
atacaatctatacttgaaaatgtagataagaaaacaggaatagtaggaactataggaaat
ataataaatggtaaactatttaaaacaaataatacaactcctgaatctttagaactccaa
aagacattctctaacatggtagaatctaaagtagataactgcataatggaagtatcgtct
catgctttagatttaaatagagtatcttactgtgattttgagacgggaatattcactaat
ttgagtgtagatcacttagattatcataaaacattagaaaactatcttgatgcaaaaata
aaacttttttatatgactaaaaaatataatattattaatgctgatgatgaatatggtaag
agaattatagagaaaataaaaaatatagatactcctctattaacttatggaatagagaat
aaatgtgatatatatgctacagatatagtgtatcatttaaatggtgttgaatttaggctt
aatactcctaagggaagcatagacataaaaatgaatataccaggagaatttagtgtatat
aatgcacttacggctgcgtcttgtggatatgcttatgacttaagtttagaagatattaaa
gtaggattagaatctgtaaaaggcgtaaaaggtagatttgaggtagttgatactgataga
gactttgtagtaataattgactttgcacatactccagatgcattagaaaaggctctaaaa
tctataaaagaatttgcaaaaagaagattagtagttctatttggtgcaggtggagataga
gataattccaaaagagcaactatgggagaaattgcaggaaaatatgctgacttttcaata
gttacttcagataacccaagaagtgaggatccaacaaaaattatagaagacatattgata
ggtactaaaaagtcaacagaaaattatatcgctattacagatagaaaagaagcaataaaa
tatgcaatagaaaacagtaagacgaatgatattatattacttgcaggaaaaggacacgaa
acttatactattataggtgaaaaaactttaccttttgacgaaagagaaattgtaaaagag
atattagcagaaacagaattaaaaagataa

DBGET integrated database retrieval system