KEGG   Gottschalkia acidurici: Curi_c14380Help
Entry
Curi_c14380       CDS       T02255                                 

Definition
(GenBank) lysyl aminopeptidase
Organism
cad  Gottschalkia acidurici
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M18 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AFS78448
UniProt: K0AXB8
Position
1528803..1529858
Genome map
AA seq 351 aa AA seqDB search
MKDLKEFIQKLSNNHGVSGYEENISTLVRDTFNEHCDETYVDSLYNTICIKKGENNSKNI
KIMLAAHMDEIGLMIKDIDEDGFLYFTTIGGFDPRVLLYQEVIIHGKDKVFGVIVPAKSI
KAYEDTSKALGIDDLKIDIGFNEKDAKELVQIGDVVTVKRELIELKNNNISGKALDDRAC
IGVMYECAKELNKFRHQSDVYFVGTVQEEVGTRGATTSTFAINPDIGIAIDVSFGYTPEL
PKERTLELGKGPGITIGGNIHTKLRAKLIEVCKEYNVPFQYEIDPGPTGTDARAIQITRC
GIPTLLISIPLKYMHTSTEVVNLTDVKTSGKLLATFISSITSDNLEGLLCY
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatttaaaagaatttatacagaaactaagcaataatcatggtgtttcaggatac
gaagaaaatatatctactttagtaagagatactttcaatgagcattgcgatgaaacttat
gtggattctttatataatacaatatgcataaaaaaaggtgaaaataattctaaaaatata
aagataatgctagctgcacatatggatgaaatagggcttatgataaaagatatagatgaa
gacggatttttatactttactacaattggtggttttgatccaagagttcttctatatcaa
gaagtaataattcatgggaaagataaagtttttggagtaatagttcctgcaaagtctatt
aaggcatatgaagatactagtaaagctttaggaattgatgacttaaaaatagacattgga
tttaatgaaaaagatgctaaagaactggtacagataggtgatgtagttacagtaaaaaga
gaattgatagagcttaaaaacaataatataagtggaaaagctctagatgatagggcttgt
ataggagttatgtacgaatgcgctaaagagttaaataaatttagacatcaatcagacgta
tattttgtaggaactgttcaagaagaagtaggaactagaggggcaactacgagtacattt
gcaataaacccggatataggaatagctatagatgtgagctttggatatacaccagaactt
cctaaagagcgaactttagaattaggaaaaggtcctggaataacaataggtggaaacata
catacaaaattaagagctaagctaattgaagtgtgtaaagaatataatgttcctttccag
tatgaaattgatccaggtccaactggtacagatgcaagagctatacaaataactagatgt
ggaataccaacattgcttatttctatacctttaaaatatatgcatacgtctacagaggta
gttaatttaacggatgttaagacttctggaaagctattagccacattcatatctagtatt
acaagtgataacttggagggattactatgctattaa

DBGET integrated database retrieval system