KEGG   Clostridium acidurici: Curi_c14390Help
Entry
Curi_c14390       CDS       T02255                                 

Definition
peptidase M42 family protein (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cad  Clostridium acidurici
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cad00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1529849..1530847
Genome map
AA seq 332 aa AA seqDB search
MLLRKLSELNGVSGNEKEVRDFIINEIKDYVADIKVDRLGNIIAYKKGLMENETKIVVSA
HMDEVGLMINKINSEGLLGFTLVGDIDSRVLISKPVLVGDNKIKGVIGAKPIHLQKKDER
KKSLEYNQLYIDIGSSSKEESEKLINIGDYVSFDSNFIDFGDNLVKGKALDNRAGCNILI
DTIKRNSDISFYAVFSVMKEIGIFGGEPANYYINPDINIILDSSFKEKSLNNGPIISFME
NRTHFSRDLTEKLASIAKDNNIDYQLSGFDCSSSDANKIQTSGNGSKIARISIPCRYEFS
PVNVMSTQDINNTEKLLIETLKLLGGNNNGNE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgctattaagaaaattatctgaattaaatggcgtatcgggaaatgaaaaagaagttaga
gattttataataaatgagattaaagactatgttgctgatattaaagttgatagattagga
aatataatagcttataaaaaaggactaatggagaatgaaactaaaattgtagtatctgca
catatggatgaagttggccttatgataaacaaaataaattctgaaggattactaggattt
acacttgttggagatattgatagtagagtattgatatccaagcctgtattagtaggagat
aataaaataaagggagttataggagctaaaccaatacatcttcaaaaaaaagatgagcgt
aaaaagtcattagaatataatcagctatacatagatatagggagtagtagtaaagaagag
tcagaaaagttaattaatattggtgactacgtatcttttgatagtaattttatagatttt
ggagataatttagtaaagggtaaggctctagataatagggcaggctgtaatatattaata
gatactataaaaagaaatagcgatatatctttctacgcagtattttctgttatgaaagaa
ataggtatatttggtggagaaccagctaactattatataaatcctgatattaatataatt
ttagatagttctttcaaggaaaaatctcttaataatggtcccataatatcttttatggaa
aatagaactcattttagtagggatttaactgagaagcttgcaagtattgctaaggataat
aatatagactatcaactgtctggttttgactgcagctcttcggatgctaataaaatacaa
acttccggcaatggatctaaaatagcgagaatatctattccttgtagatatgaattttct
ccagttaatgtaatgagtactcaagatataaacaatacagagaagttattaatagaaaca
cttaaattattaggaggtaataataatggaaatgaatag

DBGET integrated database retrieval system