KEGG   Clostridium acidurici: Curi_c14400Help
Entry
Curi_c14400       CDS       T02255                                 

Definition
peptidase M42 family protein (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cad  Clostridium acidurici
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cad00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Curi_c14400
Enzymes [BR:cad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Curi_c14400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1530840..1531829
Genome map
AA seq 329 aa AA seqDB search
MNSKLFKKLLSSYSPSGDEENITEVIKEEIKGYVDEIKVDNLGNLICHKKGTGKKVMIAA
HMDQIGLMITDIEKEGFLRFTNIGGISPLISLGQKVIFKNGTIGVLYAEEKRARKIKLDD
MYIDIGVSSKEDAEKLISIGDSCVYHSEYIEDDTRVVSGGIDDRVGCYIAIEAIKKLSTN
KNDIYFTFTVQEELGLRGAKTSSYSINPDIGISLDVTGSGDTPGATRFAVSLGKGAAIKA
KDNSIVVNPKVKNFMVEVAKENSIPYQIEVLEYGGTDSGAIHLSREGVLTGAISVPTRYI
HSPNETAFKEDIISCIKLLVSILEKDIDI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtaaactatttaaaaaactactatcttcatattctccgtctggtgatgaagaa
aacataacagaggttataaaggaagagattaaaggatatgttgatgagataaaagtagat
aatcttggaaatttgatatgtcataaaaaaggaactggaaaaaaagtaatgattgcggct
cacatggatcaaattggattgatgattacagatatagaaaaagaggggtttttaagattc
acaaacattggtggaatttcgccactaatatctttagggcaaaaggttatatttaaaaat
ggaactataggagttttatatgcagaagaaaaaagagctaggaaaataaagctggatgat
atgtatatagacattggagtaagtagtaaagaagatgctgagaagcttattagcataggt
gattcgtgtgtgtatcatagtgaatacatagaagacgatactagagtggtttcgggtgga
atagatgatagagtagggtgctacatagccatagaagctattaaaaaactatctactaac
aaaaatgatatatattttacattcactgttcaagaagaactagggcttagaggagctaaa
acatcttcttattctattaatccagatatagggatatctttagatgtaactggaagtgga
gatactccaggagctacaagatttgctgttagtcttggtaagggagctgctataaaagca
aaagataatagtatagttgttaatcctaaagttaagaattttatggtagaggttgcaaag
gaaaatagtataccttatcaaatagaagttctcgaatatggaggtacagactcaggagca
atacacctatctagagaaggggttcttacaggtgctatatccgtacctactagatatatt
catagcccgaatgaaactgcgtttaaagaagatattattagctgtataaagctattagtg
tcaatattagaaaaggatatagatatataa

  All links  
No link information was found.   
DBGET integrated database retrieval system