KEGG   Clostridium acidurici: Curi_c14480Help
Entry
Curi_c14480       CDS       T02255                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cad  Clostridium acidurici
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cad00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Curi_c14480
Enzymes [BR:cad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Curi_c14480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1538958..1539584
Genome map
AA seq 208 aa AA seqDB search
MKDRIINLVGSSGSGKTTISKKLEKIGYNIIHSYTTRKPREINEWGHKFISRQEILDMFN
INCIPKEEIINKKISIELKTNPRVIAHKELYGEHYFATIEQYKGKGTSIYVIDPEGAEVI
NKTVKDAEIITIFLQCDKSVREDRLYKRYLKNTDIEEMRDTQTIILKINERIEKDKEIFR
LCKCDYVVEVNRDIKEIIKDITTVIEEK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatagaataattaacttagtaggttcttcaggatcaggtaagactactatatcg
aaaaaactagagaaaataggatataacattattcattcatatacaactagaaaaccaaga
gaaattaatgagtggggacataagtttataagtagacaagaaatattagacatgtttaat
attaactgtattccaaaagaagagattataaataaaaaaattagcattgaacttaagaca
aatccaagggtcatagctcataaagaactgtatggagaacactattttgccactatagaa
cagtataagggtaaaggaactagtatctatgtgatagatccagaaggcgcagaagtaata
aataaaactgttaaagatgcagagataattacaatatttttacaatgtgataagtcagtt
agagaagatagactttataaaagatacttaaaaaatacagatatagaagaaatgagagac
actcaaactataattttaaaaattaatgaaagaatagaaaaagataaggagatatttaga
ctatgcaaatgtgattatgtagtagaggtcaatagggatataaaagaaattattaaagac
ataactactgtaatagaggaaaaataa

DBGET integrated database retrieval system