KEGG   Clostridium acidurici: Curi_c16890Help
Entry
Curi_c16890       CDS       T02255                                 

Gene name
gmk
Definition
guanylate kinase Gmk (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cad  Clostridium acidurici
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cad00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Curi_c16890 (gmk)
Enzymes [BR:cad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Curi_c16890 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1765284..1765886)
Genome map
AA seq 200 aa AA seqDB search
MKMGKGLLLVISGPSGAGKGTICKELLERDQNINLSISATTRSPRVGEVDKVNYFFLDRD
KFQEMIIEKEFLEYAEVYGNYYGTPKEYVLQKLDEGKDVLLEIDIQGALDVKDIYPNGVF
IFIMPPSMEELKNRIEKRGTETKEAMIRRLESAYREIEYVFKYDYAVLNDEVNLAVDKIE
SIIKAEKCKVNRQQNIIERI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgggaaaaggattacttttagttatctctggaccttctggtgctggaaaggga
actatatgtaaggaactattagagagagatcagaatataaacttatctatatctgcaaca
actagaagtccaagagttggagaagtagataaggtaaactatttctttttagatagagat
aagtttcaagaaatgattatagaaaaagaatttttagagtatgcagaagtatacggaaat
tattatggaacacctaaagaatatgtgcttcaaaaattagacgaaggaaaagatgtattg
ctagaaattgatatacaaggagcactagatgttaaagatatatatccaaatggtgtattt
atatttataatgcctccttcaatggaagaacttaaaaatagaatagaaaaaagaggaact
gaaactaaggaagcaatgataagaagactagaaagtgcatatagagaaatagaatatgta
tttaaatatgattatgcagttctgaatgatgaagtaaatttagcagtagataagatagaa
tcaataataaaggcagaaaagtgcaaagtaaatagacaacaaaatattatagaaagaata
taa

DBGET integrated database retrieval system