KEGG   Gottschalkia acidurici: Curi_c17570Help
Entry
Curi_c17570       CDS       T02255                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase HisD
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
cad  Gottschalkia acidurici
Pathway
cad00340  Histidine metabolism
cad01100  Metabolic pathways
cad01110  Biosynthesis of secondary metabolites
cad01230  Biosynthesis of amino acids
Module
cad_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cad00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Curi_c17570 (hisD)
Enzymes [BR:cad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Curi_c17570 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFS78764
UniProt: K0AZR0
Position
complement(1829234..1830526)
Genome map
AA seq 430 aa AA seqDB search
MIKIINTLDENGSVEKEIETLLNRSQLEFGEVNKSVEDIVLNVRDNKDSAVLEYTEKFDG
VRLESLLVTEKEIEEAYNDCDKELIEALEEAKQNIWDYHSKQLNNSWIDNSKKGIMLGQV
YNPIEKVGIYVPGGTAPYPSTVLMNAVPAKVAGVEEIVMVTPPGKDGKVNKHILASAKIA
GVDKIFKVGGAQGIAALAFGTETIPKVYKIVGPGNIYVAIAKRLVYGYVDIDMIAGPSEI
LVIADETANPEYVAADLLSQAEHDTLASSILVTTSAEIAEQVKEELRKQTEVLSRKDIIE
KSLKDFGAIIVAKDLEEAIKLSNAIAPEHLELMVQNPFEIISEIKNAGAIFLGQYSPEPL
GDYFAGPNHTLPTSSTAKFYSPLSTDDFVKKSSLIYYNRENLEKNKDKIIKIAESEGLTA
HANSIRVRFK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgataaagataataaatactctagatgaaaatggaagtgtagaaaaggaaatagaaact
cttttaaatagaagccaattagaatttggagaagtaaataagtcagtggaagatatagta
ctaaatgttagagataataaagacagtgctgtcttagaatacacagaaaaatttgatgga
gtacgtctagaaagtctactggtaacggaaaaagaaatagaggaagcatataatgattgc
gataaagaacttatagaagcgctagaagaagcaaaacaaaatatatgggattatcactca
aaacaacttaacaattcgtggatagataatagtaaaaaaggaataatgttaggtcaagta
tataatccaatcgaaaaggtaggtatatatgtaccagggggaacagctccatatccttca
actgttcttatgaacgctgtgccagctaaagttgcaggagttgaagaaatagttatggta
acccctccaggaaaagacggaaaggtaaacaaacatatactagcatcagctaagatagca
ggtgtagataaaatatttaaagttggaggagcacaaggaatagctgcactagcttttgga
acagagactattcctaaagtatataaaatagtaggaccgggaaatatttatgttgcaata
gctaagagattagtttacggatatgttgatatagatatgatagcaggaccaagtgaaata
ttagttatagctgatgaaactgcaaatccagagtatgttgcagcagacctattatcacaa
gcagagcatgatacactagcttcatcaatacttgtgactacttcagctgaaatagctgaa
caagttaaagaagaactgagaaaacaaacagaagtattatcaagaaaagatataatagag
aagtctttaaaagactttggagctataatagttgcaaaagatttagaagaggctattaaa
ctttcaaatgcaatagcaccagaacatttagaactaatggttcaaaatccatttgaaata
ataagtgaaatcaaaaatgcaggagctatattcctaggacagtactcaccagagccactt
ggagactattttgcaggaccaaatcacacactaccgacaagtagtactgctaaattctac
tccccattaagtacggatgatttcgttaaaaaatcaagcttaatatactataatagagaa
aacttagagaagaacaaagataagataataaaaatagcagaatcagaaggtttaacggca
catgctaactccataagagttagatttaagtag

DBGET integrated database retrieval system