KEGG   Clostridium acidurici: Curi_c20210Help
Entry
Curi_c20210       CDS       T02255                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cad  Clostridium acidurici
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Curi_c20210 (pfkA)
   01230 Biosynthesis of amino acids
    Curi_c20210 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Curi_c20210 (pfkA)
   00030 Pentose phosphate pathway
    Curi_c20210 (pfkA)
   00051 Fructose and mannose metabolism
    Curi_c20210 (pfkA)
   00052 Galactose metabolism
    Curi_c20210 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Curi_c20210 (pfkA)
Enzymes [BR:cad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Curi_c20210 (pfkA)
Protein phosphatases and associated proteins [BR:cad01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Curi_c20210 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2119238..2120197)
Genome map
AA seq 319 aa AA seqDB search
MKTIGVLTSGGDAPGMNAAIRAVVRTGIYNGIKVMGVKEGYNGLIKGNISEMNLSSVGDT
IHRGGTILRSARSDEFRTDLGKNRALTVMEIFGIEGLVVIGGDGTLRGANDLNKLGVPVI
GIPGTIDNDLAYTDLTIGFDTVVNTVVDLISNVRDTSASHGRANIIEVMGRECGDIALCS
GLAGGAESIIVPEEKLDIDEVCKKLIQGRNRGKLHSIIVLAEGAGNAYELKNSIEEKTGI
ETRVTILGHIQRGGNPTATDRIIASKMGAKSVELLMKGISGKVVGVRDNKIIDMDIDEAL
SMKKEFDSETYKLSKMISI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactataggggtacttaccagtggtggagatgcaccaggaatgaacgcagctata
agagctgtggtaagaacaggaatatataacgggattaaagttatgggagtaaaagaagga
tataatggccttataaagggcaatatatcagagatgaacctttcatccgtgggagatacc
atacacaggggaggtacgattttaagatcagctagaagtgatgaatttagaacagattta
ggcaagaatagagctttaactgtaatggagatatttgggatagaaggacttgtagttata
ggtggagatggaactcttaggggagctaatgatttaaataagctaggggttccggttata
ggaataccaggaactatagataacgacctagcctatacagaccttactataggctttgat
actgttgtaaatacagtagtagatttgataagtaatgttagggatacatctgcttcacat
ggaagagctaatataatagaagtaatgggaagagaatgtggagatattgcattgtgttcg
gggcttgcaggtggagcagaaagtataatagtgccagaagaaaaactagatatagatgaa
gtgtgtaagaaattaattcaaggaagaaacagaggtaaacttcatagtataatagtttta
gcagaaggtgcagggaatgcatatgaattaaaaaatagtattgaagaaaagacaggtata
gaaactagagtaactatactaggacacattcaaaggggaggaaatccaacagcgacagat
agaataatagctagtaaaatgggggcaaaatctgtagagcttttaatgaaaggaatttca
ggtaaagttgttggagtaagagacaataagatcatagatatggatatagatgaagctctt
tcaatgaaaaaagaatttgacagtgagacttataaactatctaaaatgatttcaatataa

DBGET integrated database retrieval system