KEGG   Gottschalkia acidurici: Curi_c20210Help
Entry
Curi_c20210       CDS       T02255                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase PfkA
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cad  Gottschalkia acidurici
Pathway
cad00010  Glycolysis / Gluconeogenesis
cad00030  Pentose phosphate pathway
cad00051  Fructose and mannose metabolism
cad00052  Galactose metabolism
cad00680  Methane metabolism
cad01100  Metabolic pathways
cad01110  Biosynthesis of secondary metabolites
cad01120  Microbial metabolism in diverse environments
cad01130  Biosynthesis of antibiotics
cad01200  Carbon metabolism
cad01230  Biosynthesis of amino acids
cad03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:cad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Curi_c20210 (pfkA)
   00030 Pentose phosphate pathway
    Curi_c20210 (pfkA)
   00051 Fructose and mannose metabolism
    Curi_c20210 (pfkA)
   00052 Galactose metabolism
    Curi_c20210 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Curi_c20210 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Curi_c20210 (pfkA)
Enzymes [BR:cad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Curi_c20210 (pfkA)
Protein phosphatases and associated proteins [BR:cad01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Curi_c20210 (pfkA)
Messenger RNA biogenesis [BR:cad03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Curi_c20210 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AFS79025
UniProt: K0B274
Position
complement(2119238..2120197)
Genome map
AA seq 319 aa AA seqDB search
MKTIGVLTSGGDAPGMNAAIRAVVRTGIYNGIKVMGVKEGYNGLIKGNISEMNLSSVGDT
IHRGGTILRSARSDEFRTDLGKNRALTVMEIFGIEGLVVIGGDGTLRGANDLNKLGVPVI
GIPGTIDNDLAYTDLTIGFDTVVNTVVDLISNVRDTSASHGRANIIEVMGRECGDIALCS
GLAGGAESIIVPEEKLDIDEVCKKLIQGRNRGKLHSIIVLAEGAGNAYELKNSIEEKTGI
ETRVTILGHIQRGGNPTATDRIIASKMGAKSVELLMKGISGKVVGVRDNKIIDMDIDEAL
SMKKEFDSETYKLSKMISI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactataggggtacttaccagtggtggagatgcaccaggaatgaacgcagctata
agagctgtggtaagaacaggaatatataacgggattaaagttatgggagtaaaagaagga
tataatggccttataaagggcaatatatcagagatgaacctttcatccgtgggagatacc
atacacaggggaggtacgattttaagatcagctagaagtgatgaatttagaacagattta
ggcaagaatagagctttaactgtaatggagatatttgggatagaaggacttgtagttata
ggtggagatggaactcttaggggagctaatgatttaaataagctaggggttccggttata
ggaataccaggaactatagataacgacctagcctatacagaccttactataggctttgat
actgttgtaaatacagtagtagatttgataagtaatgttagggatacatctgcttcacat
ggaagagctaatataatagaagtaatgggaagagaatgtggagatattgcattgtgttcg
gggcttgcaggtggagcagaaagtataatagtgccagaagaaaaactagatatagatgaa
gtgtgtaagaaattaattcaaggaagaaacagaggtaaacttcatagtataatagtttta
gcagaaggtgcagggaatgcatatgaattaaaaaatagtattgaagaaaagacaggtata
gaaactagagtaactatactaggacacattcaaaggggaggaaatccaacagcgacagat
agaataatagctagtaaaatgggggcaaaatctgtagagcttttaatgaaaggaatttca
ggtaaagttgttggagtaagagacaataagatcatagatatggatatagatgaagctctt
tcaatgaaaaaagaatttgacagtgagacttataaactatctaaaatgatttcaatataa

DBGET integrated database retrieval system