KEGG   Clostridium acidurici: Curi_c20870Help
Entry
Curi_c20870       CDS       T02255                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cad  Clostridium acidurici
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cad00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cad00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:cad02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2194862..2196358
Genome map
AA seq 498 aa AA seqDB search
MFKKKSLNQFFAITFLILIIVSSIYAKDAILKQSALGSIDAVLQQSASAPIKERPKYIFY
FIGDGLGAAQRQSADYFLQQYEGKKLLMNTFPVSGINTTHSGNTLVTDSAAAGTALATGH
KTNNGIISQLPDGTNLKTLVEVAEEKGMGTGIVTTTRLTHATPAVFASHNPSRSNESEIA
NDYVSSNVDFFAGGGIRHFIPKDYATEEDASGKSISSNRKDDRNLFKEFESKGYKTFLGK
KGAKDFSSYSPKGKEQVFAAFTNDHLPYEIDRLNSSFKDSVPTLGNITQKGIDVLSKYEN
GFFMVIEGGRIDHACHANDAVGSIHDTIALDEAISKAYEFMKKHPKETLIVVSGDHETGG
MGLGFDTNYFMQLDKLRDVKFSVGDTLMNTYDGDRAKYFNYIAKNYALSDITPEEKSKIE
NAMNIVDKNPKAVWGGSYSPVAISTTHVISNRAQIGWTTYAHSGTQIPLSVIGVGSSHFG
GFKDNTEIAKIMFSLLGK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagaaaaaatctttaaatcaattttttgctatcacttttctaatacttataatt
gtatctagtatttatgctaaagatgcaatcttaaagcaatctgcattaggttctatagat
gcagtgctgcaacaatcagcatcagctcctataaaagaacgacctaaatatattttctac
tttataggtgacggtttaggtgcagctcaaagacagtctgcagattacttcttgcagcaa
tatgaaggtaaaaagttgctaatgaacacttttcctgtgtcaggcattaatacaactcac
tcaggtaatactttagtaacagactctgctgccgctggtactgctttagcaactggtcat
aaaactaataatggtattatatcacagcttcctgatggaactaatttgaaaactttggta
gaagtcgcagaagaaaaaggcatgggaacaggaattgtaactactactcgtttaacacat
gctactcctgctgtatttgcttcccataatcctagtagaagtaatgaaagcgaaattgcc
aatgactatgtttcaagtaatgtagacttctttgctggtggagggataagacattttatt
cctaaagactatgccactgaggaagatgcctctggtaagtccatttcatctaatagaaaa
gatgatagaaatttatttaaagagtttgaaagtaaaggttataagacgtttcttggaaaa
aaaggagctaaagattttagcagttattctccaaaaggaaaggagcaagtttttgctgcc
tttactaatgatcatcttccttatgaaattgacagacttaatagcagctttaaggatagt
gttcctacgttagggaatataactcaaaaaggtatagatgtattatcaaaatatgaaaac
ggctttttcatggtgattgaaggcggaagaatagatcatgcctgtcatgctaatgatgca
gttggatctattcacgatactatagctcttgatgaagctattagtaaagcttatgagttt
atgaaaaaacatcctaaagaaacccttatagttgtttctggggatcatgaaacaggtggt
atggggctaggatttgatactaattattttatgcaactagataaattaagagatgtaaaa
ttctctgtaggtgatactttaatgaatacttatgacggagatcgtgccaagtattttaac
tacatagctaaaaactatgctctttccgatataactccagaagaaaaatctaaaatagaa
aatgctatgaatattgtagacaaaaaccctaaagctgtttggggtggctcttactctcct
gtagctatatctactactcatgtaatatcaaatagggctcaaattggatggactacttac
gctcacagtggtactcaaattcctttatctgttattggagtaggttctagccactttgga
ggattcaaagataatactgaaattgctaaaatcatgtttagcttgcttggaaaataa

DBGET integrated database retrieval system