KEGG   Clostridium acidurici: Curi_c21040Help
Entry
Curi_c21040       CDS       T02255                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cad  Clostridium acidurici
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cad00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2226912..2227394)
Genome map
AA seq 160 aa AA seqDB search
MSKQAYLGIGGNIGDTRGNIERSIELLKENSEIQVTQISSFYETEPVGYTDQDWFLNIVV
EIKTSLEPFDLLKYCQYIENELKRERVIRWGPRTIDVDVLLYEGFISDDEVLTVPHPRMT
ERAFAMIPLYEINKNLVINDKNIKDIVEELKGEEIKKYNI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcaggcttatcttgggatcggtggaaatataggagatactagaggcaatata
gaaagatctatagagttgctaaaagagaacagtgaaatacaagtaactcaaatatcttct
ttttatgaaactgagcctgtaggatatactgatcaagattggtttttaaatattgttgta
gagataaaaactagtttagaaccatttgatttactaaaatactgtcaatatatagagaat
gagttaaagagagaacgagttataagatggggacctagaactatagatgtagatgtactt
ttatacgaaggttttatatctgatgatgaggttcttactgtacctcatcctagaatgact
gaaagagcattcgcgatgattcctctatatgagattaataaaaatttagtaataaatgat
aaaaatataaaagatatagtggaagaactaaaaggcgaagaaataaaaaaatataacata
taa

DBGET integrated database retrieval system