KEGG   Gottschalkia acidurici: Curi_c27900Help
Entry
Curi_c27900       CDS       T02255                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
cad  Gottschalkia acidurici
Pathway
cad00010  Glycolysis / Gluconeogenesis
cad00030  Pentose phosphate pathway
cad00051  Fructose and mannose metabolism
cad00680  Methane metabolism
cad01100  Metabolic pathways
cad01110  Biosynthesis of secondary metabolites
cad01120  Microbial metabolism in diverse environments
cad01130  Biosynthesis of antibiotics
cad01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Curi_c27900 (fbp)
   00030 Pentose phosphate pathway
    Curi_c27900 (fbp)
   00051 Fructose and mannose metabolism
    Curi_c27900 (fbp)
  Energy metabolism
   00680 Methane metabolism
    Curi_c27900 (fbp)
Enzymes [BR:cad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Curi_c27900 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: AFS79783
UniProt: K0B191
Position
complement(2936059..2938056)
Genome map
AA seq 665 aa AA seqDB search
MVYANDEITKEFEDEIRYLKLLAKQYPTIAEVCTEIINLQAILNLPKGTEHFLTDIHGEY
ESFNHVLKNASGVIKRKIKDSLGTSISEKDAKTLATLIYYPEQKLKIITEHEKNIDEWYR
VTLYRLVEICRHVSSKYTRHKVRKALPKDFAYIIEELLHEHPDRMDKEKYYNEIVKTIIR
IGRANEFIIAISNLIQRLVIDRLHIIGDIFDRGPGSDIVMDTLINYHSVDIQWGNHDILW
MGAAAGSEACIATVLRICARYVNLDTIEDGYGINLLPLATFALDFYKDDECLAFKPKVGD
NMNYSEKDLKLVSQMHKAISIIQFKLEGEIIKRRPHLGMEDRLLLNEIDYEKGTINLYGK
MYKLNDNKFPTISPNNPYELTSEEKELMERLKSSFLNSERLQKHIRFLFTKGSMYLKYNS
NLLYHGCIPLNEDGTFKKVKIGRTGREYSGKAYLDRLETLVREGYFQKDDPDVNLYGLDL
TWYLWTGCDSPLFGKDKMTTFERYFVDDKETHNEKKNPYFRIEDNEDICNMIFKEFDLNP
EVSHIINGHVPVKIKKGESPIKANGKLLVIDGGFSRAYQGTTGIAGYTLIYNSYGLLLAS
HEPFESTQKAIEEEQDILSTTVVLEREVERKRVGDTDIGEELRTQIKDLEMLLNVYRKGI
VKEQK
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggtttacgctaatgatgaaataactaaagaatttgaagatgaaataagatacttaaaa
cttttagccaagcaatatccaactatagcggaagtatgtacagaaataataaacttacaa
gcaatattgaaccttcctaaggggacagaacactttttaacagatattcatggtgaatac
gaatcttttaatcatgtcctgaaaaatgcatctggagttataaagcgtaagataaaggat
tctctaggcacatctataagcgaaaaagatgcgaaaacacttgcaactcttatttactac
ccagaacaaaaattaaagattatcactgaacatgagaaaaatatagatgaatggtataga
gtcactttatatagacttgtagagatttgcaggcacgtatcttcaaaatatactagacat
aaagtaagaaaagctcttccaaaagatttcgcatatataatagaagaactcttgcatgaa
catcctgatagaatggataaagaaaaatactataacgagatagttaaaactataataaga
ataggaagagctaatgagtttataatagcaatatcaaatctaattcaaagattagtaata
gatagattacatattattggagatatatttgataggggtcctggatctgatattgtaatg
gatacccttataaattatcattctgttgatatacaatggggaaatcatgatatattatgg
atgggagctgctgccggaagtgaagcttgtattgcaacagtccttagaatttgtgctaga
tatgtaaacttagatactatagaagatggatacggaataaaccttcttcctttagctaca
tttgctttagatttctataaagatgacgaatgcttagcttttaaacctaaggttggagat
aatatgaattatagtgaaaaggatttaaagcttgtatctcaaatgcataaagctatatct
ataatccaatttaaattagaaggagaaataattaagagacgtcctcacttaggtatggaa
gatagacttttattaaatgaaattgattatgagaaaggtacaatcaacctatatggcaaa
atgtacaagctaaatgataataagttcccaactataagtcctaataacccttatgagctt
acttcagaagaaaaagaacttatggaaagacttaagtcatcttttctaaatagtgaaaga
cttcaaaagcatatcagatttcttttcactaagggaagtatgtatttaaaatataattca
aatttactgtatcatggatgtattccactgaatgaagatggaacatttaagaaagtaaaa
ataggccgtacaggaagagaatatagtggaaaggcttatcttgataggttagaaacttta
gtaagagaaggctatttccaaaaagatgatcctgatgttaatttatatggattagatttg
acctggtatttatggactggatgcgattcacctctttttggaaaggataaaatgactaca
tttgaaaggtattttgtagatgataaggagactcacaatgaaaagaaaaatccttatttc
agaatagaagataatgaggatatatgcaatatgatatttaaagagtttgatttaaatcct
gaggtttctcatataattaatggacatgttcctgttaaaataaaaaagggagaaagtcct
ataaaagcaaatggtaagctcttagttatagatggtggattttcaagagcttatcaggga
acaacaggaatagctggatatactcttatatataactcatatggtcttctactagcgtct
catgagccttttgaatctactcaaaaagccattgaggaagagcaagatattctttcaact
acagtagttcttgagagagaagttgaaagaaaacgagttggagatacagatattggagag
gaattgagaactcaaataaaggatttagaaatgcttttaaatgtttatagaaaaggaatt
gttaaagagcagaaataa

DBGET integrated database retrieval system