KEGG   Clostridium acetobutylicum DSM 1731: SMB_G0099Help
Entry
SMB_G0099         CDS       T01548                                 

Gene name
hemD
Definition
uroporphyrinogen III syntase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cae00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
106555..108027
Genome map
AA seq 490 aa AA seqDB search
MKRSGKVYIIGAGPGEEELITLKAIRKMKECTAVLYDRLVGQGILKYLNEKCEIYYCGKE
PGCHYKTQDEINEMIIKLAKEGHIVGRIKGGDPYIFGRGGEEGLSLLKENIEFEVISGVT
SPVAVLNYAGIPVTHRGIARSFHVFTAKTANDDSINFSAAAKIDGTLIFLMGYRQLNDIT
RKLIENGMDSKMPCAVVMRGTTSLQKKVIGNLSDIKEKCDNANMTSPCIIVVGKVVGFNQ
QLNWYEKKPLFGRNICITRSKNQSKTMREELLDLGAEVTEVHSIEIENTASNLEEYINKI
SEYDYIILTSVNAVEVLFDYLASKDYDVRKVRAKFAVIGNATKEALKKRGIVPEIVSRKH
NGEGLFDEIRGYLKKDDKIFIPRSENSRKYIKEQLVSLGLSVDECFIYRTVPGKLYDKAA
FENADTIVFTSPSTVKNMIALFGEKNIKKKSIIAIGPITGRELGKINAEYSTCSECSVDA
IIRECLNSDK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatctggtaaggtttatataataggagcaggacctggagaggaagagcttata
accttaaaggcaataagaaaaatgaaagaatgcacagctgtgctttatgatagacttgta
ggacagggaatacttaaatatttgaatgaaaagtgtgagatttattattgtggaaaagag
cctgggtgtcattataaaacccaagatgagataaatgaaatgataataaagctagctaaa
gaaggacatattgttggtagaataaaaggaggagacccatatatttttggaagaggaggg
gaagagggactaagtcttttaaaagagaatatagaatttgaagtgatttcaggggttact
tctcccgtagctgttttaaattatgctggaattcctgtaacgcacaggggcatagcaaga
agctttcatgtatttacggcaaaaacagccaatgacgattctataaattttagtgcagcg
gctaaaattgatgggacactgatatttttaatgggatataggcagcttaacgatataact
agaaagctaatagaaaatggaatggattcaaaaatgccctgcgctgttgtaatgagggga
actactagtcttcagaaaaaggttataggaaatcttagtgatataaaagaaaaatgtgat
aatgctaatatgacttcaccttgtataatagtagtaggaaaagttgttggtttcaatcag
cagctaaattggtatgagaaaaagcctctttttggcagaaatatatgtataacaagatct
aaaaatcaaagcaaaactatgagagaagagcttcttgaccttggagcagaagtaacagaa
gtacattctatagaaatagaaaatacagcctcaaatttagaagaatacattaataaaatt
tcagagtatgattatataatcttgaccagtgtaaatgctgtggaggtcttatttgattat
cttgcttcaaaggattatgatgtaagaaaagtaagggccaagtttgcagttataggaaat
gctacaaaagaagcgctaaagaaaagaggaattgttccagagatagtatctagaaaacac
aatggagaaggtctttttgatgagattagaggctatttaaagaaggatgataagatattt
atccccaggagtgaaaattctagaaagtatataaaggaacaacttgtaagcttagggtta
agtgttgacgagtgttttatatacagaacagttcctggaaagctttatgataaggctgct
tttgaaaatgctgatacaattgtttttacaagtccatcaacggtaaaaaatatgatagct
ctttttggagaaaagaacataaagaaaaagagtataatcgccataggacctataacagga
agagagcttggaaaaataaatgcagaatattctacatgcagtgaatgcagtgtagatgca
ataattagggagtgtttgaacagtgacaaataa

DBGET integrated database retrieval system