KEGG   Clostridium acetobutylicum DSM 1731: SMB_G0187Help
Entry
SMB_G0187         CDS       T01548                                 

Definition
beta-glucosidase-like protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cae00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:cae00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
206067..207629
Genome map
AA seq 520 aa AA seqDB search
MVMIDVKKLPLDIKIGQMIMAGFTSKHYDSSLEKLITDDKIGNFILFSRNIEEKNQLTRL
TEDIQKGLEINIKIPGIISVDQEGGMVTRINSGTTIFPGNMAFAAANHPHSTFRQGKIEG
EELRGLGVNMNLAPVMDVNCNPSNPVIGVRSYSDSPEKVAELGLELIKGLKESKVVPVAK
HFPGHGDTDVDSHLSLPVVKHSIKRLRKVELLPFKTAIENGIDAIMSAHVLFPEIEPKRL
PATLSYRVLTDLLRNKMGFKGIIITDCMEMKAIAEFYGSDKAAVMAIKAGADLICISHSA
AVQKACIRRIKEAVINKEISEERINESVKRILEIKEKYSISFNTVKRNYDINNSLFAEEI
SDKSITLLKNDKSLIPLKGRIVSISTKAVALTGAEDNMSLNNSFCHKLKENFGGSEFQIP
INPHKEIIDKILEKCLDADSIVIGIYNAYNHEGQRKLVNEISKVNPNIVLVSLRNPYDFL
YFKEVSAYINAYEYTNLSVKSVIKVLSGRVEAQGISPVRL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggttatgattgatgtaaaaaagcttcctcttgatataaaaataggacaaatgataatg
gcagggtttacttcaaagcattacgattcttctttggaaaaactgattacagatgataag
ataggaaatttcatattgttttcgagaaatatagaagagaaaaatcagctcacaaggctt
acagaggatattcaaaaaggactagaaatcaatattaaaattccaggaattatttctgtt
gatcaagaaggtggaatggttacaagaataaattcagggactacaatatttcctggaaat
atggcttttgcagcagcaaatcatccacatagcacttttagacagggaaaaattgaggga
gaagagcttagaggtttgggtgtaaatatgaatctagcaccagttatggatgtgaactgt
aatcccagtaacccagttataggagttaggtcttatagtgatagtcctgaaaaagtagca
gaactgggtttggaattaataaaaggtttaaaagaaagtaaggtagttccagttgcaaag
catttcccgggacatggagatacggatgtggattctcaccttagtttgcctgtagtaaag
cattctattaaaaggcttcgtaaagtcgagcttcttccatttaagactgcaatagaaaat
ggaattgatgcaataatgtcagcacatgtgctctttccagaaatagaacccaaaaggctt
cctgctacactttcatatagggttcttacagatttattaagaaataaaatgggttttaag
ggcattataataacagattgcatggagatgaaggctatagcagagttctatggcagtgat
aaggcagcagttatggcaattaaagcaggagcagatttaatttgtatatcccatagtgcg
gcggtacagaaagcttgtatacgtagaattaaagaagcagtaataaataaagaaatctct
gaagagagaataaatgaatcagtaaaaagaattctagaaataaaagagaaatatagcatt
tcatttaatacagtcaaaagaaactatgatataaataatagtcttttcgcagaagaaata
agtgataaaagcataacacttctaaagaacgataaaagtttaatcccacttaaaggaagg
attgtatccatatctacaaaagcagtagcacttactggggctgaagataatatgagccta
aacaattctttttgtcataaattaaaagagaactttggtggcagtgaatttcaaatacca
attaatccccataaagaaataatagataaaatattagaaaaatgcctagatgcagatagt
atagtaataggtatttataatgcatacaatcatgaaggtcaaagaaaacttgtgaatgaa
ataagtaaggttaatcctaatatagtactggtatccttaaggaatccctatgatttttta
tattttaaggaagtttcagcttatataaatgcctatgaatacactaatttgtcagtaaaa
agtgtaattaaagtattatcgggaagagtagaggctcaagggatttcaccagttagactt
tag

DBGET integrated database retrieval system