KEGG   Clostridium acetobutylicum DSM 1731: SMB_G0220Help
Entry
SMB_G0220         CDS       T01548                                 

Gene name
frvX
Definition
(GenBank) aminopeptidase M42 family endoglucanase
Organism
cae  Clostridium acetobutylicum DSM 1731
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
239735..240745
Genome map
AA seq 336 aa AA seqDB search
MLLDKLCNAAGPSSFEGDVRAIIKKEIKAFVDEIKVDRMGNIIAHKKGSGKKIMLDAHMD
EVGFIITSINEDGTIKFASIGGINGKIIPSKVVYIGENKIPGVIGIKPIHLQSAEERKGS
ASYDNCFIDIGSKSKEETKKYVSLGDYAVFSTEYGEFGEGFIKAKALDDRVGCAVLIELL
KENYECDLYAVFNVQEEVGERGAYVSAFQVRPDIGIALEGTVCADMPNVPEYLRATELGK
GPAISIMDKSSIYNEEITLELIKIAKENNLAHQMRKSTSGGNDAGAIASTGEGAKVAAVS
VPCRYIHSSVSVASLKDIENTIELLKKYLLSFKGGK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcttttagataaactttgcaatgcagctgggccttcatcctttgaaggagacgtaaga
gctatcataaaaaaagaaattaaggcctttgttgatgagataaaggtagatagaatgggc
aatataatagcacataaaaagggcagcggaaaaaagataatgctggatgcacatatggat
gaggttggatttataataacatcaatcaatgaagatggtacaataaaatttgcgtccatt
ggaggcattaatggtaaaattataccctcaaaggttgtctatataggtgaaaataaaatt
ccaggagtgataggaataaagcctatacaccttcaaagtgctgaagagagaaaaggcagt
gcatcatatgataattgctttatagatattgggtcaaaatctaaagaggaaacaaaaaaa
tatgtgtcattaggagattatgctgtattttcaactgaatatggtgaatttggtgaaggt
tttattaaagcaaaagcgcttgatgatagagttggctgcgctgttttaatagagctttta
aaggaaaattatgagtgtgatttatatgcagtatttaatgttcaggaagaagtaggagaa
agaggtgcatatgtatcagcatttcaggttagacctgatattggaattgcccttgagggg
acagtatgtgcggatatgcctaatgtacctgaatatttaagagccacagaactcggaaaa
gggcctgctatttctattatggataaaagcagcatatataatgaagagataacattagag
ttgataaaaatagctaaagaaaacaatttggcacatcagatgagaaaatcaacatctggt
ggaaatgatgcaggtgctattgcgtcaactggagaaggagctaaggtagcggcagtttct
gtaccatgcagatatatacattcctctgtttcagttgcgagtttaaaagacattgaaaat
actatagagttattaaagaaatatttattgagctttaaagggggaaaataa

DBGET integrated database retrieval system