KEGG   Clostridium acetobutylicum DSM 1731: SMB_G0221Help
Entry
SMB_G0221         CDS       T01548                                 

Gene name
celM
Definition
aminopeptidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cae00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SMB_G0221 (celM)
Enzymes [BR:cae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SMB_G0221 (celM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
240747..241688
Genome map
AA seq 313 aa AA seqDB search
MDMLLKKILGTFGVSGREKEISEVIKEELNKYPCEVREDKLGNIIVKLGSGREKIMLSTN
MDKKGVITYHIEEDGKVRIDAIGDIKADDIIGKTVVFRSGIEGKIESEKKENNEFRDIYV
NVNMGKREAVLKYISEGEAAEFGGNTFADKENVVGPYLSNRAGCYAFLKVIKEIKSIDKE
VYFVFSTQGNLNGRGARAAAFEIEPDMCISVNTEKEGEVKLSEGPILVLMEKGLITNYHV
KEQIISSAEKAQIKLQRCVSSESSDGSVVHKEVGGIKTGTIALPCKNKNETNETISLNDV
DDLVKLLQYIVKK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggatatgttgctaaaaaaaattcttggtacctttggagttagtggaagagaaaaagaa
atatcggaagttataaaagaggaattaaataaatatccctgcgaagttagagaagataaa
ctagggaatattatagtaaagcttgggtctggaagagaaaaaataatgttaagtacgaac
atggataagaagggggtaattacttatcatatagaagaagacggtaaagttagaattgat
gccataggagatattaaggcagatgatatcataggtaaaactgttgtttttagaagtgga
atagaaggaaaaatagagtctgagaagaaagaaaataatgaatttagagatatttatgtc
aatgtaaatatgggtaaaagagaagccgtattaaaatatataagtgagggagaggctgct
gaatttggtggtaatacctttgcagataaagaaaatgtagttggcccatatttgagtaat
agagcaggatgctatgcttttcttaaggtgattaaggagattaaaagcatagacaaagaa
gtgtattttgtattttctactcagggaaatttaaatggtaggggagctagagcggctgct
tttgaaatagaaccagatatgtgtatttcagtaaatacagaaaaagaaggagaagtaaag
ctttctgaaggccctatacttgttcttatggagaagggacttataactaattatcatgta
aaagaacagattattagtagtgctgaaaaagctcagataaaacttcaaagatgtgtttct
agtgaaagtagtgatggaagcgtggtacataaggaggtaggcggaataaaaacaggcacc
atagcgcttccttgcaaaaataaaaatgaaacaaatgagactataagtttaaatgatgtg
gatgatttagttaagttactacaatacattgtaaagaagtaa

DBGET integrated database retrieval system