KEGG   Clostridium acetobutylicum DSM 1731: SMB_G0221Help
Entry
SMB_G0221         CDS       T01548                                 

Gene name
celM
Definition
(GenBank) aminopeptidase M42 family endoglucanase
Organism
cae  Clostridium acetobutylicum DSM 1731
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
240747..241688
Genome map
AA seq 313 aa AA seqDB search
MDMLLKKILGTFGVSGREKEISEVIKEELNKYPCEVREDKLGNIIVKLGSGREKIMLSTN
MDKKGVITYHIEEDGKVRIDAIGDIKADDIIGKTVVFRSGIEGKIESEKKENNEFRDIYV
NVNMGKREAVLKYISEGEAAEFGGNTFADKENVVGPYLSNRAGCYAFLKVIKEIKSIDKE
VYFVFSTQGNLNGRGARAAAFEIEPDMCISVNTEKEGEVKLSEGPILVLMEKGLITNYHV
KEQIISSAEKAQIKLQRCVSSESSDGSVVHKEVGGIKTGTIALPCKNKNETNETISLNDV
DDLVKLLQYIVKK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggatatgttgctaaaaaaaattcttggtacctttggagttagtggaagagaaaaagaa
atatcggaagttataaaagaggaattaaataaatatccctgcgaagttagagaagataaa
ctagggaatattatagtaaagcttgggtctggaagagaaaaaataatgttaagtacgaac
atggataagaagggggtaattacttatcatatagaagaagacggtaaagttagaattgat
gccataggagatattaaggcagatgatatcataggtaaaactgttgtttttagaagtgga
atagaaggaaaaatagagtctgagaagaaagaaaataatgaatttagagatatttatgtc
aatgtaaatatgggtaaaagagaagccgtattaaaatatataagtgagggagaggctgct
gaatttggtggtaatacctttgcagataaagaaaatgtagttggcccatatttgagtaat
agagcaggatgctatgcttttcttaaggtgattaaggagattaaaagcatagacaaagaa
gtgtattttgtattttctactcagggaaatttaaatggtaggggagctagagcggctgct
tttgaaatagaaccagatatgtgtatttcagtaaatacagaaaaagaaggagaagtaaag
ctttctgaaggccctatacttgttcttatggagaagggacttataactaattatcatgta
aaagaacagattattagtagtgctgaaaaagctcagataaaacttcaaagatgtgtttct
agtgaaagtagtgatggaagcgtggtacataaggaggtaggcggaataaaaacaggcacc
atagcgcttccttgcaaaaataaaaatgaaacaaatgagactataagtttaaatgatgtg
gatgatttagttaagttactacaatacattgtaaagaagtaa

DBGET integrated database retrieval system