KEGG   Clostridium acetobutylicum DSM 1731: SMB_G0393Help
Entry
SMB_G0393         CDS       T01548                                 

Gene name
bglC
Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cae00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
448321..449730
Genome map
AA seq 469 aa AA seqDB search
MKFPKDFFLGAASASYQVEGAWNEDGKGVSNWDVFTKIPGKTFEGTNGDVAVDHYHRYKE
DVKLMAEMGLDSYRFSVSWPRIIPDGDGEINQKGIEFYNNLIDECLKYGIVPFVTLYHWD
MPEVLEKAGGWTNKKTVDAFVKYAKACFEAFGDRVKRWITFNETIVFCSNGYLSGAHPPG
ITGDVKKYFQATHNVFTAHARSVIEYKKLKQYGEIGITHVFSPAFSVDDKEENKAAAYHA
NQYEITWYYDPILKGKYPEYVIKNIEKQGFLPDWTDEELNTLREAAPLNDFIGLNYYQPQ
RVIKNHDTGEKIERTRENSTGAPGNASFDGFYRTVKMDDKTYTKWGWEISPESLILGLEK
LKEQYGDIKIYITENGLGDQDPIIEDEILDMPRIKFIEAHLRAIKEAISRGINLKGYYAW
SVIDLLSWLNGYKKQYGFIYVDHKHNLDRKKKLSFYWYKKVIEERGKNI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttccaaaggatttctttttaggtgctgcttctgcatcataccaggtagagggt
gcctggaatgaagatggaaagggagtatctaactgggatgtatttaccaaaataccagga
aaaacttttgaaggtactaatggagatgttgcagtagaccactaccatagatacaaagaa
gacgtaaaactgatggcagaaatgggacttgattcatacagattctccgtttcttggcca
agaataataccagatggtgatggagaaataaatcaaaagggaatagagttttacaataat
ttgatcgatgagtgccttaaatatggcattgtaccatttgttaccttgtatcactgggat
atgccagaggtactggagaaggctggaggatggacaaataaaaaaactgtagatgccttt
gtaaagtatgctaaagcgtgttttgaagcgtttggagatagggtaaagcgctggattact
tttaatgagactatagtgttttgcagcaatggatacttaagtggagctcacccgcctggt
ataacaggagatgttaaaaagtattttcaagcaacacacaatgtatttacagctcatgcc
agatcagttattgaatataaaaaattaaaacagtatggcgaaataggaataacgcatgta
ttctcaccagccttcagtgttgatgataaggaagaaaataaggctgctgcatatcatgca
aatcaatatgagattacctggtattacgatccaatattaaagggaaaataccccgaatat
gtaattaaaaatatagaaaaacaaggatttttaccagattggacagatgaggaattgaat
acattaagggaggcagctccgcttaatgactttataggacttaactactatcaacctcaa
agagtaattaaaaatcatgacacaggggaaaaaattgaaagaacaagggagaactctaca
ggggcacctggaaatgcatcctttgatggattttatagaacagtaaaaatggacgacaaa
acttacactaaatggggctgggagatatcacctgaatcattaattttggggcttgagaaa
ttgaaagaacagtatggtgatatcaaaatttatattactgaaaacggtttaggcgatcag
gatccaataatagaagatgaaattcttgatatgcctagaataaaattcatagaagctcat
ttaagagcaataaaagaagctataagtagggggataaaccttaaaggatattacgcttgg
tcagtaatcgatcttttaagttggcttaacggatacaaaaaacagtatggttttatatat
gtagaccataaacacaatttagatagaaagaagaaattatcattttattggtataaaaaa
gtaatagaagaaagaggtaaaaatatatag

DBGET integrated database retrieval system