KEGG   Clostridium acetobutylicum DSM 1731: SMB_G0527Help
Entry
SMB_G0527         CDS       T01548                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Class
Metabolism; Overview; Carbon metabolism [PATH:cae01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cae01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cae00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cae00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cae00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cae00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cae00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
596212..597171
Genome map
AA seq 319 aa AA seqDB search
MKTIAVLTSGGDAPGMNAAIRAVVRTAIEKGINVKGIQRGYSGLINGEIFDMNRHSVSDI
IQRGGTILRTARCPEFLKEEVRQKAANVLRVFGIDGLVVIGGNGSFMGAQKLSKLGVKTV
GLPGTIDNDLPYTDYTIGFDTTLNTVLDAINKLRDTSTSHERVSIIEVMGRDCGDIALFS
GIAGGAESVIIPEIGYDFNELCKNILEGKLRGKMHNLIILAEGVGGAAELAKKVEEVTGI
ETRSTILGHIQRGGSPSAFDRMLASRMGVKAVEVLMEGKTSRVIGIKEGKIMDQDIDEAL
AVPRSFNKELYDIANMLSK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatagctgttttaacgagtggtggagatgcaccaggtatgaatgctgctata
agagcggtagtaagaactgccattgaaaagggtattaatgttaagggcatacaaagaggg
tacagtggccttataaatggcgaaatatttgatatgaatagacacagcgtatcagatata
atacaacgaggaggcactattttaagaacagcacgttgtccagaatttcttaaagaagaa
gttagacaaaaggcagcaaatgttttaagggtttttggtatagatggtctcgttgtaata
ggtggaaatggttcttttatgggagcacaaaagctttctaagcttggagtaaagacggtt
ggacttccgggaacaatcgataatgatcttccatatacagattacaccataggttttgat
actacacttaatactgtattagacgcaattaataaacttagagatacttctacttctcat
gaaagagtaagtataatcgaggttatgggaagagattgcggtgatatagctctgttttct
ggaatagctggaggagcagaaagtgtaataatacctgaaattggttatgattttaatgag
ctttgtaaaaacatcttagaaggaaaattaagaggaaaaatgcataatcttataatactt
gcagaaggtgttggaggagcagctgagcttgcaaaaaaagttgaagaagttactggtata
gaaaccagatccacaatacttggtcatattcaaagaggaggaagtccatcagcctttgat
agaatgcttgcatctagaatgggagtaaaggctgtagaagtcttaatggaaggaaaaacc
tctagagttataggtattaaagaaggaaaaataatggatcaagatattgatgaggcttta
gcagttccaagaagttttaataaagagttatatgatatagcaaatatgctttcaaaatag

DBGET integrated database retrieval system