KEGG   Clostridium acetobutylicum DSM 1731: SMB_G0527Help
Entry
SMB_G0527         CDS       T01548                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:cae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMB_G0527 (pfkA)
   01230 Biosynthesis of amino acids
    SMB_G0527 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMB_G0527 (pfkA)
   00030 Pentose phosphate pathway
    SMB_G0527 (pfkA)
   00051 Fructose and mannose metabolism
    SMB_G0527 (pfkA)
   00052 Galactose metabolism
    SMB_G0527 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SMB_G0527 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SMB_G0527 (pfkA)
Enzymes [BR:cae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SMB_G0527 (pfkA)
Protein phosphatases and associated proteins [BR:cae01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SMB_G0527 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
596212..597171
Genome map
AA seq 319 aa AA seqDB search
MKTIAVLTSGGDAPGMNAAIRAVVRTAIEKGINVKGIQRGYSGLINGEIFDMNRHSVSDI
IQRGGTILRTARCPEFLKEEVRQKAANVLRVFGIDGLVVIGGNGSFMGAQKLSKLGVKTV
GLPGTIDNDLPYTDYTIGFDTTLNTVLDAINKLRDTSTSHERVSIIEVMGRDCGDIALFS
GIAGGAESVIIPEIGYDFNELCKNILEGKLRGKMHNLIILAEGVGGAAELAKKVEEVTGI
ETRSTILGHIQRGGSPSAFDRMLASRMGVKAVEVLMEGKTSRVIGIKEGKIMDQDIDEAL
AVPRSFNKELYDIANMLSK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatagctgttttaacgagtggtggagatgcaccaggtatgaatgctgctata
agagcggtagtaagaactgccattgaaaagggtattaatgttaagggcatacaaagaggg
tacagtggccttataaatggcgaaatatttgatatgaatagacacagcgtatcagatata
atacaacgaggaggcactattttaagaacagcacgttgtccagaatttcttaaagaagaa
gttagacaaaaggcagcaaatgttttaagggtttttggtatagatggtctcgttgtaata
ggtggaaatggttcttttatgggagcacaaaagctttctaagcttggagtaaagacggtt
ggacttccgggaacaatcgataatgatcttccatatacagattacaccataggttttgat
actacacttaatactgtattagacgcaattaataaacttagagatacttctacttctcat
gaaagagtaagtataatcgaggttatgggaagagattgcggtgatatagctctgttttct
ggaatagctggaggagcagaaagtgtaataatacctgaaattggttatgattttaatgag
ctttgtaaaaacatcttagaaggaaaattaagaggaaaaatgcataatcttataatactt
gcagaaggtgttggaggagcagctgagcttgcaaaaaaagttgaagaagttactggtata
gaaaccagatccacaatacttggtcatattcaaagaggaggaagtccatcagcctttgat
agaatgcttgcatctagaatgggagtaaaggctgtagaagtcttaatggaaggaaaaacc
tctagagttataggtattaaagaaggaaaaataatggatcaagatattgatgaggcttta
gcagttccaagaagttttaataaagagttatatgatatagcaaatatgctttcaaaatag

DBGET integrated database retrieval system