KEGG   Clostridium acetobutylicum DSM 1731: SMB_G0720Help
Entry
SMB_G0720         CDS       T01548                                 

Gene name
eglA
Definition
endo-1,4-beta glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cae00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
816043..818211
Genome map
AA seq 722 aa AA seqDB search
MKRNRMKILNLPIFFVVLMFLLSNVGIIRVKANNLTPVEINGQLKVSGSKLLNSNNQPIQ
LKGMSSFGIQYSPQFVNYNTMKYLRDNWGMNVFRVAMYTDGDGGYIFNKAACKAKVEEAV
NAAQKLGIYVIVDWHMFNNPQTDKSQSKDFFNQISSEYKNSPNVIYEIANEPCGDVTWGR
DIKPYANEVIPVIRANSPNAIVIVGSPTWSQSVLDPANDPLSFSNVMYACHFYAGTHGQW
LRDRITQALNKNIALFATEWGTSDCNGSGGTYIEESQRWVDFMTQNKISWTNWVLDDANA
TASILKPGSNPNGGWTDNDLTESGKFVKAAMLQNNTPTTGGNTTPTTGGNTTPTTGGNTT
PTTGGNTTPTTGGNTTPTTGGNTTPTTGGNTTPTTGGNTTPTTGGNTTPTTGAVIDTSKT
YKIISSSTGKVLNVRNYSSQSGAQIEELVDVGALSEQWKIADSGNGSYKITSALSNLSLD
GGVSTEGTDVKQYQYAGAENQQWNIEKINANTYKITNKKSNLALETTGVYDSADIQLWNY
TGKGTQQWIISDVNAGTNTTPTTGGNTTPTTGGNTTPTTGSAIDNSKTYKIISQNTGKVL
NVRNYSSESGAQIEELVDVGALSEEWKITNSGNGSYKITSALSNFSLDAGTSTEGSDVKQ
YQYTGAESQQWNIEKIAANTYKITNKKSGLALNGTGAWDGSNLQLAKYSSTADQQWILKA
VN
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaatagaatgaaaattttaaatttaccaatattttttgtagtactaatgttt
ttactatcaaatgttggtattattagggtcaaagcaaacaatttaacaccagttgaaata
aatggtcaacttaaggtttcaggaagtaaattactaaattcaaacaatcaacctattcaa
ctcaaaggtatgagtagttttggtatacaatactcgccacagtttgtaaattataatact
atgaaatatttaagagacaactggggaatgaatgtatttagagttgctatgtatactgac
ggagatggaggatatatatttaataaggcagcttgtaaagcaaaggttgaagaggctgta
aatgctgctcaaaagttaggtatatatgtaattgttgattggcatatgtttaataatcct
caaactgataaaagtcagtcaaaggacttctttaatcaaatttcaagcgaatataaaaat
tcacctaatgtaatctatgaaatagcaaatgaaccatgtggcgatgtaacttggggaaga
gatataaaaccatatgcaaatgaggttataccagttattagagccaattcgcctaatgca
atagttatagttggtagtcctacatggagtcaatctgttctagatcctgccaatgatcct
ttaagcttcagtaatgtaatgtatgcgtgccatttttatgctggaacacatggtcaatgg
cttagagatagaataacacaagctcttaacaaaaacatagctttatttgctacagaatgg
ggaactagtgattgcaatggtagtggaggaacttacatagaagaatctcaaagatgggta
gattttatgacccaaaataaaataagttggactaattgggttttagatgatgcaaatgca
acagcatcaatattaaagcctggaagtaatcctaatggaggatggactgacaatgatttg
acagagtcaggaaagtttgtaaaggcggctatgcttcaaaataatacaccaactacaggt
ggaaacacaacaccaactacaggcggaaacacaacaccaactacaggtggaaacacaaca
ccaactacaggtggaaacacaacaccaactacaggtggaaacacaacgccaactacaggt
ggaaatacaacgccaactacaggtggaaatacaacaccaactacaggtggaaatacaacg
ccaactacaggtggaaatacaacgccaactacaggagctgtaatagatactagtaaaaca
tataaaataatatcttcaagtacaggtaaggttttaaatgtaagaaactatagttctcaa
agcggagcacaaatagaagaattagttgatgttggtgcgttatcagaacagtggaaaata
gcggattcaggcaatggaagctataaaattacttctgcattgagtaatttaagcttagat
ggtggtgtaagtactgaaggaactgatgttaaacaatatcaatatgcaggtgcagaaaat
cagcagtggaatattgaaaaaataaatgccaatacttataaaatcacaaataagaaaagt
aatttagcattagaaactactggagtttatgatagtgcagatattcaactttggaattac
acaggaaaaggaactcaacagtggataatttcagatgtgaatgcaggaacaaatacaaca
ccaactacaggcggaaatacaacaccaactacgggtggaaatacaacaccgactacagga
agtgctatagataatagtaaaacatataaaataatatctcaaaatacaggtaaagtttta
aatgtaagaaattatagttctgaaagtggagcacaaatagaagagttagttgatgttggc
gcactatccgaagaatggaaaataacaaattcaggtaatggaagctataaaattacgtct
gctttaagtaattttagtttggatgcaggtacaagtactgagggttctgatgttaaacag
tatcagtatactggcgcagaaagtcaacagtggaatattgaaaaaattgctgctaatact
tataaaataacaaataagaaaagcggtttagctttaaatggaactggagcttgggatggt
tctaaccttcaattagctaaatatagcagtacagcagatcagcagtggatacttaaggct
gttaactaa

DBGET integrated database retrieval system