KEGG   Clostridium acetobutylicum DSM 1731: SMB_G0759Help
Entry
SMB_G0759         CDS       T01548                                 

Gene name
abgA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cae00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
862607..864022
Genome map
AA seq 471 aa AA seqDB search
MGVKFPEGFLWGGATAANQFEGAYNQDGKGLSIQDIMPKGIRGPITDKPTEDNMKLIGID
FYNRYKEDIKLFAEMGFKTFRLSIAWSRIFPNGDDKQPNEKGLQFYDNVFDELAKYNIEP
LVTISHYETPLALAKNYDGWTNRKLIGFFENYVRTIFNRYKNKVKYWLTFNEINSALHAP
YMSAGIWTPKEKLSKQDLYQAMHHELLASALAVKIGHEINPEFKIGCMILGVPNYPLTSK
PSDVLKAMNQDRENLFFADVHARGRYPKYMNRLFKENNVHIKMEPGDEEILKNTVDFISF
SYYMSSCATSDTKKSKGGAGNIISGVPNPYLKASEWGWQIDPEGLRYILNLLYDRYQKPL
FIVENGLGAVDELITDERGNKTVNDDYRINYLNDHLVQVGEAIEDGVELMGYTTWGCIDL
VSASTAELKKRYGFIYVDRHDDGSGTLERYKKKSFYWYKEVIATNGASLKK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgggagttaaatttccggaaggatttttatggggaggagctacggctgctaaccaattt
gaaggagcttataatcaagatggtaagggcttatctattcaagatataatgccaaaaggt
ataagaggacctataactgataagccaacagaagataatatgaaacttataggtattgat
ttttataacagatataaagaagacataaagttgtttgcagagatgggctttaaaaccttt
agattatcaattgcgtggtctagaatattcccaaatggtgatgataagcagccaaatgaa
aagggacttcaattttatgacaatgtatttgatgaattagctaagtataatattgagcct
ttagttacaatatctcattatgaaacaccattagcacttgctaaaaattatgatggttgg
actaatagaaaactcataggcttttttgaaaattatgttaggacaatatttaatagatat
aaaaataaggtaaaatattggctcacttttaatgaaataaattcagctctccacgctcct
tatatgagtgctggaatatggacaccaaaggaaaagttgagcaaacaagatttatatcaa
gctatgcatcatgaattacttgccagtgctcttgcagttaagataggtcatgaaataaat
ccggaatttaaaataggatgtatgattcttggagtaccaaactatcctcttacttcaaag
ccaagcgatgttcttaaagcaatgaatcaggatagagaaaatcttttctttgcagatgtt
catgcaagaggaaggtatccaaaatatatgaatagattatttaaggaaaataatgtacat
ataaagatggagccaggggatgaagaaatattaaaaaatacagtagactttatttctttt
agctattacatgagttcatgtgcaacatccgacactaaaaagagtaagggaggggcagga
aatattatttctggagtgccaaatccttatttgaaggcttcagaatggggatggcaaata
gatccagaaggattaaggtatatactcaatttgttatatgatagatatcaaaagccttta
tttatagttgaaaatggtttaggtgctgtggatgaattaataacagatgaaagaggtaac
aaaaccgtaaatgatgattatagaatcaactatctaaatgatcatttggttcaagtagga
gaggccatagaagatggtgttgagctaatgggttacactacttggggatgtatagattta
gtaagtgcatcaactgctgaacttaagaaaagatatggttttatatatgtagataggcat
gatgatggaagtggtacattagaaagatataagaagaaaagtttttattggtataaggaa
gttatagctacaaatggagctagtttaaagaaataa

DBGET integrated database retrieval system