KEGG   Clostridium acetobutylicum DSM 1731: SMB_G1016Help
Entry
SMB_G1016         CDS       T01548                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMB_G1016 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMB_G1016 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SMB_G1016 (thrC)
Enzymes [BR:cae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SMB_G1016 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1144882..1146372
Genome map
AA seq 496 aa AA seqDB search
MNHIYYKSTRNNDVSILASRAILKGISDDGGLYVPERVPELDFDIKDIVNMDYKEIAYKV
MKTFFTDFTEEELKYCIENAYDSKFDTEEIAPIKKAGDTYFLELYHGPTLAFKDMALSIL
PYLLKTASKKNGIQDKIVILTATSGDTGKAALEGFKDVEGTEIIVFFPNDGVSEVQRLQM
VTQKGKNTHVVAIRGNFDDAQSGVKKIFTDKEFIQELKENNCVFSSANSINIGRLVPQIV
YYFYAYSKMCSKGEINFGEKINFVVPTGNFGNILAAYFAKSMGVPINKLICASNDNKVLY
DFFENGTYDRNREFVTTISPSMDILISSNLERLIYLVCDRDSSKVADFMRELSEGGKYNI
TENMKKKLKDFYAGYATEEETKKAIEKMYKENKYLIDTHTAVAYSVYEKYLKNTKDKAKT
VIASTASPYKFTNAVMTSLDNKYASYDDFELMKKMSEVINKDIPSGVKGLNERKVIHKDI
CSKDEMKKIVRSFLGK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacatatattataaaagtaccagaaataatgatgttagtattttagcgtctaga
gctattttaaagggtatatctgatgatggtggcttgtatgtaccagagagagtaccagag
cttgattttgatattaaagatattgttaatatggattataaagaaatagcttataaagtt
atgaagactttttttaccgattttactgaagaggagctcaagtactgcattgaaaatgcc
tatgacagcaaatttgatacagaagaaatagctcctataaaaaaggcaggagatacatat
tttttagaattatatcatggtcctaccttagcatttaaggatatggcactttcaatttta
ccatatcttttaaaaactgcttcaaagaaaaatggaattcaggataaaatagttatttta
acagcaacatctggcgataccggaaaagcagcattagaaggttttaaggatgttgaaggt
accgagataatagtgtttttcccgaatgatggagtgagtgaagttcaaagacttcaaatg
gtaacacagaaaggaaaaaatacacatgttgtggctataagaggaaactttgatgatgct
caaagcggagttaaaaaaatatttacggacaaagaatttatacaggagcttaaagagaat
aattgtgtattttcatctgcaaactcaattaacataggaagattagttcctcagatagta
tattatttttatgcttattctaagatgtgctcaaaaggtgaaattaattttggagaaaag
ataaattttgttgttcctacaggcaattttggaaatatactagcagcatattttgctaag
agtatgggagtgcctattaataagctaatatgtgcttcaaatgacaataaagttctttat
gatttctttgaaaatggaacttatgatagaaatagagagtttgtaactacaatatcacct
tccatggatattttaatttcaagtaaccttgaaagacttatttatcttgtatgcgataga
gattcaagcaaggtggctgattttatgagagagcttagtgaaggcggaaaatataatata
acagagaatatgaagaaaaaacttaaggatttttatgctggatatgctacagaggaagaa
actaaaaaggctatagaaaaaatgtataaagaaaataaatatcttatagacactcatacg
gctgtagcttatagtgtgtatgaaaaatatttaaagaatacgaaggataaagcaaaaact
gttatagcgtcaactgcaagtccatacaaatttacaaatgcagttatgacctctcttgat
aataaatatgcttcttacgacgattttgaactcatgaagaagatgagtgaggttataaat
aaggatataccaagtggtgttaaaggacttaatgaaagaaaagttattcataaagatatt
tgtagtaaagatgaaatgaaaaaaatagttagaagttttttaggtaagtag

DBGET integrated database retrieval system