KEGG   Clostridium acetobutylicum DSM 1731: SMB_G1344Help
Entry
SMB_G1344         CDS       T01548                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cae00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SMB_G1344 (glpK)
Enzymes [BR:cae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SMB_G1344 (glpK)
Exosome [BR:cae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SMB_G1344 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1463024..1464520
Genome map
AA seq 498 aa AA seqDB search
MKKYIIALDQGTTSSRAIIFDHEQNILEISQKEFTQIYPSKGWVEHNPLEIWSSQYGVLQ
EVMAKANITQENIAAIGITNQRETTIVWDKNTGEPVYNAIVWQCRRTADIVEGLKRDKEF
SDYVKENTGLILDAYFSATKIKWILDNVEGAREKAEKGELLFGTVDTWLVWKLTNGKVHV
TDYTNASRTMLYNIKELKWDERILRKLNIPRSMLPEVKNSSEVYGYTNLGGKGGIRVPIA
GMAGDQQCALFGQTCFEEGSVKNTYGTGCFLLMNTGENIIQSKNGLVTTIAIGLEGKVQY
ALEGSVFVGGAVIQWIRDELKLVSDAADTEYFAKKVNDNGGVYVVPAFTGLGAPYWDMYA
RGAIFGLTRGANKNHIIRAALEAIAYQSRDLIDAMKEDSGCEITRIKVDGGASRNNLLMQ
FQADITGTEVVRPIITETTALGAAYLAGLAVGFWKSKEEIAEKWSVSEVYTPNLDEDEKI
RLYNGWKRAVERVQGWEE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatatataatagcattagatcaaggaactacaagttcaagagcaataatattt
gaccatgaacaaaatatattagaaattagtcaaaaggaatttactcaaatctatccgagt
aaaggatgggttgagcataatcctttagagatatggtcaagtcaatatggagttttgcaa
gaagtaatggcaaaagctaatataactcaagaaaatattgcagcaataggaattactaat
caaagagaaacaacaattgtttgggacaaaaatactggagaacctgtgtataatgctatt
gtatggcagtgtagaagaacagcagatatagtggaaggacttaagagagataaagagttt
tcagattatgtaaaagaaaatacaggattaatattagatgcatatttttcagcaacaaaa
ataaagtggatattagataatgtagagggtgcaagagaaaaagctgaaaaaggtgaattg
ctatttggtacagttgatacttggcttgtatggaagctaacaaatggcaaagtccatgta
accgattacacaaatgcatctagaactatgctttataatataaaggaattaaaatgggat
gaaagaattttaagaaaacttaatattccaagatcaatgctaccagaagttaaaaattca
tccgaagtttatggatatacaaaccttggaggtaaaggtggtattagagtaccaatagca
ggcatggcaggagatcaacaatgtgcattatttggtcaaacctgttttgaagaaggtagt
gttaaaaatacttatggcacaggatgctttttacttatgaatacaggagaaaatataatt
cagagtaaaaatggactagtaacgacaattgcaattggattagaagggaaagttcaatat
gcattagaaggttcagtgtttgttgggggggcagttattcagtggattagagatgaactt
aagttagttagcgatgctgcggatacagagtattttgctaaaaaagtgaatgacaatggt
ggagtatatgtggtaccagcatttactggtcttggagctccatattgggatatgtatgct
agaggagcaatttttggtctgacaagaggcgcaaataaaaaccatataattagagcggca
cttgaagctattgcatatcagtcaagagatcttatagatgcaatgaaagaagattcggga
tgtgaaattacaagaattaaagttgatggaggagctagtagaaataatttattaatgcag
tttcaagcagacattacaggaacagaagttgtaagacctataataactgaaacaacagca
cttggtgcagcttatttagccggacttgctgtaggcttttggaagtcaaaagaagaaatt
gccgagaagtggtctgtgagtgaggtgtatactccgaatttagatgaggatgagaaaata
agattatataacggttggaagagagcagttgaaagagttcagggctgggaagaataa

DBGET integrated database retrieval system