KEGG   Clostridium acetobutylicum DSM 1731: SMB_G2050Help
Entry
SMB_G2050         CDS       T01548                                 

Gene name
aor
Definition
aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMB_G2050 (aor)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SMB_G2050 (aor)
Enzymes [BR:cae01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     SMB_G2050 (aor)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2130521..2132575)
Genome map
AA seq 684 aa AA seqDB search
MNSKVIDNNIVYINLSEKKVTYERITCEYRKKYIGGTGINTKILFESEAMYNDALSEKNV
LIFGAGAAVGTSLLTGNRSTITAKSPLTDIYGDSNIGGSFPTTMRSVGIDHLVFQGKSEN
PIYIFIDEKGNVKFEDASDLWGFYTDKTTDILSKRHNNCEISCIGPAGENLIRYASVFMS
KTHVAGRMGMGCIMGSKKLKAIVIERKKCEVPMYNREKIRSISKLWIEQSHTSIQFKVMG
LSGTLLLMDKYGEAKCLPVENAQRGYDKKCENLSPMVFKKEFETKKVPCKFCTLGCGKAY
EIKKGKYKGEKGERIEYGSATSFGPNVGIYDYSDVLHLKLLCDKLGMDTIEVAATIALIL
ECQKRGVLREDITEGRKFQFGNVDDIEYLMHKISDRSGIGDILAEGAYRASKTLKVEKYA
FCIKKASTGLHSNQKKAWSLGYITSTRGGDHLKDFPFTSVFSNPLTDSLGTHIFKRKFKG
TLSKDKEQGRVVWWHENYKYVIDSLGICLFCMQSITPQGHAFFDEFAEILSALFNIEVTK
EDMFYAGERIYQLQNAFNINCGMKLEDYKWPSREKEEDIEDEFIKDSTIEVRDSPGMLPE
YFYFRGLSSEGFPTTKRFKELQLDEYIERIKVDDSAITDSFENLLLKVSLNVNLKFMEKL
IGRLVYKIVAKKIDKQVALLNQNK
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgaattctaaagtgatagataataatatagtgtacataaacctatctgaaaaaaaggtg
acatacgagagaataacttgtgaatatagaaagaagtatattggaggaactggtataaat
acaaaaatactttttgagtctgaagctatgtataatgatgctttatcagaaaaaaatgta
ttgatatttggtgcaggtgctgcagttggtacaagtctccttacaggtaatcgtagtaca
ataactgctaaaagtccattaacagatatatacggagattctaatataggaggaagtttt
ccaacaactatgagatcagttggaatagatcacttagtatttcaaggtaaatcagaaaat
cctatatatatttttatagacgaaaagggtaatgttaaatttgaagatgcttctgattta
tgggggttctatacagataaaactacagatattttgtcgaagaggcataataattgtgaa
atatcatgtataggtcctgctggtgaaaatttgatacgttatgcaagcgtatttatgtca
aaaacacatgtagctggacgcatgggcatgggatgtataatgggatcaaagaaattaaaa
gctattgtaattgaacgcaaaaaatgtgaagttcctatgtataatagggaaaaaatcaga
tctatatcgaagctttggatagaacaaagtcatacatcgattcaattcaaggtaatgggt
ctcagtggtacgttattactaatggacaaatatggtgaagctaaatgtctgccagttgaa
aatgctcaacgaggctatgataaaaaatgcgaaaatttatcacctatggtatttaagaaa
gagtttgaaactaagaaagtgccatgtaaattttgtacattaggatgtggaaaagcttat
gaaattaaaaagggaaaatataagggtgagaaaggcgaaagaatagaatatggttctgca
accagttttggacctaatgttggtatatatgattattcagatgtgctgcatttaaaatta
ttatgcgataagctgggaatggatactatagaagtagcggctacaatagctctgatttta
gaatgtcaaaaacgtggagttttaagggaagatattactgaaggcagaaaatttcaattt
ggaaatgtggatgacatagaatatcttatgcataagataagtgatcgttctggaataggt
gatatacttgccgaaggtgcatacagagcatctaagacactgaaggttgaaaaatatgca
ttttgtataaaaaaggcgtcaacaggacttcattccaatcaaaaaaaagcatggtcttta
ggttatattacatctactcgaggcggagatcatttgaaggattttccgtttacatcagtt
ttttctaatcctcttacagattcattgggcacacatatatttaaaagaaagtttaaaggt
actttaagtaaagataaggaacagggaagagttgtgtggtggcatgaaaattataaatat
gtaattgattctttaggaatttgtttattttgtatgcagagtattacaccacagggacat
gcattctttgatgaatttgcagaaatattaagtgcattatttaatattgaggttacaaaa
gaggatatgttttatgcaggtgaaaggatttatcagcttcaaaatgcttttaatataaat
tgcggaatgaagcttgaggattataaatggccatcaagagaaaaagaagaagatattgaa
gatgaattcattaaagattcaacaattgaagtaagggattcaccaggaatgttgccagag
tatttctattttaggggattaagcagtgagggatttcctactactaaacgttttaaggaa
ctgcagctagatgaatatatagaaagaattaaagtagatgatagtgcaattacagattca
tttgaaaacttattattaaaagtaagtttgaatgtaaatcttaagttcatggagaagcta
ataggtcgcttagtatataaaatagttgcaaaaaaaatagataaacaagttgctttatta
aatcaaaataagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system