KEGG   Clostridium acetobutylicum DSM 1731: SMB_G2050Help
Entry
SMB_G2050         CDS       T01548                                 

Gene name
aor
Definition
aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cae01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cae00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2130521..2132575)
Genome map
AA seq 684 aa AA seqDB search
MNSKVIDNNIVYINLSEKKVTYERITCEYRKKYIGGTGINTKILFESEAMYNDALSEKNV
LIFGAGAAVGTSLLTGNRSTITAKSPLTDIYGDSNIGGSFPTTMRSVGIDHLVFQGKSEN
PIYIFIDEKGNVKFEDASDLWGFYTDKTTDILSKRHNNCEISCIGPAGENLIRYASVFMS
KTHVAGRMGMGCIMGSKKLKAIVIERKKCEVPMYNREKIRSISKLWIEQSHTSIQFKVMG
LSGTLLLMDKYGEAKCLPVENAQRGYDKKCENLSPMVFKKEFETKKVPCKFCTLGCGKAY
EIKKGKYKGEKGERIEYGSATSFGPNVGIYDYSDVLHLKLLCDKLGMDTIEVAATIALIL
ECQKRGVLREDITEGRKFQFGNVDDIEYLMHKISDRSGIGDILAEGAYRASKTLKVEKYA
FCIKKASTGLHSNQKKAWSLGYITSTRGGDHLKDFPFTSVFSNPLTDSLGTHIFKRKFKG
TLSKDKEQGRVVWWHENYKYVIDSLGICLFCMQSITPQGHAFFDEFAEILSALFNIEVTK
EDMFYAGERIYQLQNAFNINCGMKLEDYKWPSREKEEDIEDEFIKDSTIEVRDSPGMLPE
YFYFRGLSSEGFPTTKRFKELQLDEYIERIKVDDSAITDSFENLLLKVSLNVNLKFMEKL
IGRLVYKIVAKKIDKQVALLNQNK
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgaattctaaagtgatagataataatatagtgtacataaacctatctgaaaaaaaggtg
acatacgagagaataacttgtgaatatagaaagaagtatattggaggaactggtataaat
acaaaaatactttttgagtctgaagctatgtataatgatgctttatcagaaaaaaatgta
ttgatatttggtgcaggtgctgcagttggtacaagtctccttacaggtaatcgtagtaca
ataactgctaaaagtccattaacagatatatacggagattctaatataggaggaagtttt
ccaacaactatgagatcagttggaatagatcacttagtatttcaaggtaaatcagaaaat
cctatatatatttttatagacgaaaagggtaatgttaaatttgaagatgcttctgattta
tgggggttctatacagataaaactacagatattttgtcgaagaggcataataattgtgaa
atatcatgtataggtcctgctggtgaaaatttgatacgttatgcaagcgtatttatgtca
aaaacacatgtagctggacgcatgggcatgggatgtataatgggatcaaagaaattaaaa
gctattgtaattgaacgcaaaaaatgtgaagttcctatgtataatagggaaaaaatcaga
tctatatcgaagctttggatagaacaaagtcatacatcgattcaattcaaggtaatgggt
ctcagtggtacgttattactaatggacaaatatggtgaagctaaatgtctgccagttgaa
aatgctcaacgaggctatgataaaaaatgcgaaaatttatcacctatggtatttaagaaa
gagtttgaaactaagaaagtgccatgtaaattttgtacattaggatgtggaaaagcttat
gaaattaaaaagggaaaatataagggtgagaaaggcgaaagaatagaatatggttctgca
accagttttggacctaatgttggtatatatgattattcagatgtgctgcatttaaaatta
ttatgcgataagctgggaatggatactatagaagtagcggctacaatagctctgatttta
gaatgtcaaaaacgtggagttttaagggaagatattactgaaggcagaaaatttcaattt
ggaaatgtggatgacatagaatatcttatgcataagataagtgatcgttctggaataggt
gatatacttgccgaaggtgcatacagagcatctaagacactgaaggttgaaaaatatgca
ttttgtataaaaaaggcgtcaacaggacttcattccaatcaaaaaaaagcatggtcttta
ggttatattacatctactcgaggcggagatcatttgaaggattttccgtttacatcagtt
ttttctaatcctcttacagattcattgggcacacatatatttaaaagaaagtttaaaggt
actttaagtaaagataaggaacagggaagagttgtgtggtggcatgaaaattataaatat
gtaattgattctttaggaatttgtttattttgtatgcagagtattacaccacagggacat
gcattctttgatgaatttgcagaaatattaagtgcattatttaatattgaggttacaaaa
gaggatatgttttatgcaggtgaaaggatttatcagcttcaaaatgcttttaatataaat
tgcggaatgaagcttgaggattataaatggccatcaagagaaaaagaagaagatattgaa
gatgaattcattaaagattcaacaattgaagtaagggattcaccaggaatgttgccagag
tatttctattttaggggattaagcagtgagggatttcctactactaaacgttttaaggaa
ctgcagctagatgaatatatagaaagaattaaagtagatgatagtgcaattacagattca
tttgaaaacttattattaaaagtaagtttgaatgtaaatcttaagttcatggagaagcta
ataggtcgcttagtatataaaatagttgcaaaaaaaatagataaacaagttgctttatta
aatcaaaataagtaa

DBGET integrated database retrieval system