KEGG   Clostridium acetobutylicum DSM 1731: SMB_G2276Help
Entry
SMB_G2276         CDS       T01548                                 

Gene name
asnO
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cae00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SMB_G2276 (asnO)
Enzymes [BR:cae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SMB_G2276 (asnO)
Peptidases [BR:cae01002]
 Cysteine Peptidases
  Family C44
   SMB_G2276 (asnO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2339627..2340820
Genome map
AA seq 397 aa AA seqDB search
MCGIAGFVNFKKNLIDKKSIIEDMTNTLIKRGPNEKGYYISKNALLGHRRLIVVDPKGGS
QPMIKIHNGKKYIIVYNGELYNTEDIRKELLEAGYEFSSYSDTEVLLTSYIHWKEDCVNH
INGIFAFAIYSETDKKIFLARDPLGVKPLFYTIKNNNLIFGSEIKTLLANPLVEPILTKE
GLTEIFALGPARNLGSGVLKDIHEIPPANFIEFTEHKFKLHEYWRLSCKPHTENASETAE
HIKFLLTDAIKRQLYADVPVCTFLSGGLDSSIISAVAASEFKKHGKTLNTYSIDYKDNNL
YFKNDNFVITPDSVWAEKMRKFIGSNHHKIINNNLDLASALYDAVKANDIPGMADIDSSL
FLFCKGVAEKNVVSLSGERAIQMITNLVKQFINIGEL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatagctggatttgttaatttcaaaaaaaacttgattgacaaaaaaagtatt
atagaagatatgactaatactcttataaagagggggccaaatgaaaaaggctactatata
tcaaaaaatgctcttttgggccacagacgtcttatcgttgtagaccctaaaggtggtagt
caaccaatgataaaaatacacaatggaaaaaagtatattatagtttataatggcgagtta
tataatactgaggacatacgaaaggagcttttagaagcaggttatgaattttcatcatac
tctgatacagaagttcttttaacttcctacattcattggaaagaagattgcgtaaatcat
ataaatggaatttttgcttttgcgatatactctgaaactgataaaaaaatttttcttgca
agggatccattaggagtaaaacctttattttatacaataaaaaataacaacttaatattt
ggatctgaaataaaaactcttcttgcaaatcctcttgttgaaccaattttaacaaaagag
ggtttaacagaaatttttgcactaggtcctgctagaaatctcggcagtggagttttaaaa
gatattcatgaaattccacctgcaaactttatagagtttacggagcacaaattcaagctt
catgaatattggcgcttaagctgtaagcctcatactgaaaatgcaagtgaaacagcagag
catataaagtttcttcttacagatgcaataaaacgtcaactatatgcagacgtacccgta
tgtacttttctttcaggaggacttgactccagcataatttcagctgtagctgcaagtgaa
ttcaaaaaacatggaaaaactttaaatacttattctattgattataaagataataaccta
tactttaaaaacgataactttgtaataactcctgatagtgtctgggctgaaaaaatgcgt
aaatttataggcagtaatcatcacaaaataataaataataatttagatttagcatctgca
ttatatgatgctgtaaaggcaaatgacattcccggtatggccgacatagactcttctctc
tttttattctgtaaaggtgttgctgaaaaaaatgtagtttcactatcaggtgaacgtgca
atacagatgataactaatctagttaaacaatttataaatataggggagttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system