KEGG   Clostridium acetobutylicum DSM 1731: SMB_G2276Help
Entry
SMB_G2276         CDS       T01548                                 

Gene name
asnO
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cae00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2339627..2340820
Genome map
AA seq 397 aa AA seqDB search
MCGIAGFVNFKKNLIDKKSIIEDMTNTLIKRGPNEKGYYISKNALLGHRRLIVVDPKGGS
QPMIKIHNGKKYIIVYNGELYNTEDIRKELLEAGYEFSSYSDTEVLLTSYIHWKEDCVNH
INGIFAFAIYSETDKKIFLARDPLGVKPLFYTIKNNNLIFGSEIKTLLANPLVEPILTKE
GLTEIFALGPARNLGSGVLKDIHEIPPANFIEFTEHKFKLHEYWRLSCKPHTENASETAE
HIKFLLTDAIKRQLYADVPVCTFLSGGLDSSIISAVAASEFKKHGKTLNTYSIDYKDNNL
YFKNDNFVITPDSVWAEKMRKFIGSNHHKIINNNLDLASALYDAVKANDIPGMADIDSSL
FLFCKGVAEKNVVSLSGERAIQMITNLVKQFINIGEL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatagctggatttgttaatttcaaaaaaaacttgattgacaaaaaaagtatt
atagaagatatgactaatactcttataaagagggggccaaatgaaaaaggctactatata
tcaaaaaatgctcttttgggccacagacgtcttatcgttgtagaccctaaaggtggtagt
caaccaatgataaaaatacacaatggaaaaaagtatattatagtttataatggcgagtta
tataatactgaggacatacgaaaggagcttttagaagcaggttatgaattttcatcatac
tctgatacagaagttcttttaacttcctacattcattggaaagaagattgcgtaaatcat
ataaatggaatttttgcttttgcgatatactctgaaactgataaaaaaatttttcttgca
agggatccattaggagtaaaacctttattttatacaataaaaaataacaacttaatattt
ggatctgaaataaaaactcttcttgcaaatcctcttgttgaaccaattttaacaaaagag
ggtttaacagaaatttttgcactaggtcctgctagaaatctcggcagtggagttttaaaa
gatattcatgaaattccacctgcaaactttatagagtttacggagcacaaattcaagctt
catgaatattggcgcttaagctgtaagcctcatactgaaaatgcaagtgaaacagcagag
catataaagtttcttcttacagatgcaataaaacgtcaactatatgcagacgtacccgta
tgtacttttctttcaggaggacttgactccagcataatttcagctgtagctgcaagtgaa
ttcaaaaaacatggaaaaactttaaatacttattctattgattataaagataataaccta
tactttaaaaacgataactttgtaataactcctgatagtgtctgggctgaaaaaatgcgt
aaatttataggcagtaatcatcacaaaataataaataataatttagatttagcatctgca
ttatatgatgctgtaaaggcaaatgacattcccggtatggccgacatagactcttctctc
tttttattctgtaaaggtgttgctgaaaaaaatgtagtttcactatcaggtgaacgtgca
atacagatgataactaatctagttaaacaatttataaatataggggagttataa

DBGET integrated database retrieval system