KEGG   Clostridium acetobutylicum DSM 1731: SMB_G2279Help
Entry
SMB_G2279         CDS       T01548                                 

Gene name
pldB
Definition
lysophospholipase L2 PLDB
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cae00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SMB_G2279 (pldB)
Enzymes [BR:cae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SMB_G2279 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2342111..2343202)
Genome map
AA seq 363 aa AA seqDB search
MRKLSKKVFLIFAVTTIFILGNSAWDRTIASEEDNSMIDGKPKEYYISEKNYKREIKQVE
NYLSARRESGHFIGKENIDIYYEKYVIPNSKNSIVISHGFRESMVKYNETIYYFLKNGYS
VYGLEHRGHARSGRLGKDSTQTSVDNFDYYVDDFKKYVDTIVEPDNRGKNLFLYAHSMGG
AIGGLFLERYPKYFKAAVLSSPMFEVDTGRYPEFLSRAVASVFNFVNLGDTYAPGHHEYS
CESDFENSCTTSNIRYDYYLDKTNKSRKIENGGASFKWVKESLKATDEVTDGKNASKVTI
PVLLFQAENDDIVRPGGQDKFAKEAKKCKLIVIKNSKHEIYREKDSIMVPYFNKVFTFLN
NNK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagttaagtaagaaggtttttttgatttttgctgtaacaacaatttttattctt
ggaaattcagcttgggataggaccatagcatctgaagaggataattctatgattgatgga
aaacctaaagagtattatataagtgaaaaaaactataaaagagaaataaagcaagttgaa
aattatcttagtgctaggcgagaatcagggcattttattggaaaggaaaatatagatatt
tactacgaaaaatatgttataccaaattcaaagaattcaattgtaatatcccatgggttt
agggagagtatggtaaagtataatgaaacaatatattattttttgaaaaatggatattcc
gtatatggattggaacatagaggccatgcaagatcaggtagattaggaaaagattcaaca
caaacaagtgtagataattttgattattatgtagatgattttaaaaaatatgttgatact
atagtagaaccggataatagagggaaaaatttattcttatatgcacattctatgggagga
gcaattggaggcttatttctagaaaggtatcctaaatatttcaaagccgcagttttaagt
tctccaatgtttgaggtagatacgggaagataccctgaatttttgtcaagagctgttgca
agtgtatttaactttgtgaatttaggagatacatatgctcctggtcaccatgagtattct
tgtgaatcggattttgaaaattcctgcacaacaagtaatattagatatgattattattta
gataaaactaacaagagtagaaaaattgaaaatggtggagcttcgtttaagtgggtaaag
gaatctttaaaggcaacagatgaggttacagacggaaaaaatgcatcaaaagtaactatt
ccagtgttgttatttcaagccgaaaatgatgatatagtaaggccaggaggacaagataag
tttgcaaaagaagctaagaagtgtaaactaatagtgattaagaattcaaagcatgaaata
tatagagaaaaggatagtataatggttccatatttcaataaggtatttacttttcttaat
aacaataagtag

DBGET integrated database retrieval system