KEGG   Clostridium acetobutylicum DSM 1731: SMB_G2283Help
Entry
SMB_G2283         CDS       T01548                                 

Gene name
yngB
Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cae00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SMB_G2283 (yngB)
   00052 Galactose metabolism
    SMB_G2283 (yngB)
   00500 Starch and sucrose metabolism
    SMB_G2283 (yngB)
   00520 Amino sugar and nucleotide sugar metabolism
    SMB_G2283 (yngB)
Enzymes [BR:cae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SMB_G2283 (yngB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2346138..2347001)
Genome map
AA seq 287 aa AA seqDB search
MSIRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEATLSGIEEILIIIGRNK
KSIEDHFDKSAELEEELKNNHKEELLRMVRQVSNMVNIYYVRQKEPMGLGHAISLAKSFA
GNEAFAVMLGDDIVDSKVPCLKQLMDCYDRYNTSILGVQEVRKKDVCKYGIVDGINIENK
ICKVKNLVEKPSIEMAPSNIAILGRYIITPTIFPILENTKPGKGGEVQLTDALEELLKRE
AIYSYCFDGKRYDIGDKLGFIEANIDFALKNDKLNSELKEYLLNINK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgagcataagaaaagctgtgattccagcagcaggtttaggaacaaggttccttccagct
acaaaagctcagccaaaggaaatgttacctatagttgataaacctacaatacagtatata
gttgaagaggcaactttatcaggaattgaagaaatacttataataattggaagaaataaa
aaatcaatagaagatcattttgacaaatcggcagagcttgaagaagaactaaaaaataac
cataaggaagaacttcttcggatggttaggcaggtaagtaatatggttaacatatactat
gtgcgccaaaaggagcctatgggattaggacatgctattagtttggcaaaaagttttgca
ggaaatgaagcttttgcagttatgcttggggacgatatagtggacagtaaagtcccctgt
ttaaagcagcttatggactgctatgatagatataatacgtctatattaggagttcaggaa
gtaagaaagaaggatgtttgtaaatatggaattgtggatggaataaacatagaaaataaa
atatgcaaggtcaaaaatttagttgaaaagcctagtatagaaatggcaccttctaatata
gctattcttggaaggtatattataacgccaactatatttcctatactggaaaatacaaaa
cctggaaaaggtggagaagttcagcttacagatgcattagaagaattgctaaagagagaa
gcaatatattcatattgttttgatggcaaaagatatgatattggagataaacttggattt
atagaggcaaatatagattttgcacttaaaaatgataaactaaacagtgaacttaaggaa
tatctactcaacataaacaaatag

DBGET integrated database retrieval system