KEGG   Clostridium acetobutylicum DSM 1731: SMB_G2369Help
Entry
SMB_G2369         CDS       T01548                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
cae00040  Pentose and glucuronate interconversions
cae00052  Galactose metabolism
cae00500  Starch and sucrose metabolism
cae00520  Amino sugar and nucleotide sugar metabolism
cae01100  Metabolic pathways
cae01130  Biosynthesis of antibiotics
Module
cae_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cae00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SMB_G2369
   00052 Galactose metabolism
    SMB_G2369
   00500 Starch and sucrose metabolism
    SMB_G2369
   00520 Amino sugar and nucleotide sugar metabolism
    SMB_G2369
Enzymes [BR:cae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SMB_G2369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AEI32286
Position
complement(2444060..2444971)
Genome map
AA seq 303 aa AA seqDB search
MRVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVQSGIEEILVITGRNK
RAIEDHFDKSFELESELESHNKKELLKVVKDISNLANIYYIRQKEPRGLGHAINCARTFV
GNEPFAVLLGDDVVNAKVPCLKQLINCYNEYKTSILGVQRVPNSEVSKYGIVNGMHIEDG
VYKVKDLVEKPKQEEAPSDLAILGRYIITPSIFDILDNTKPGKGDEIQLTDALKTLMKTE
AMYAYVFSGRRYDVGDKLGFLQATVEYALKREELKKPFMNYLFTIKDNPNFKSLYDELNK
KSK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagagttaaaaaagctataataccagcagcggggttaggaacaagatttttaccagca
actaaggcacaacctaaggaaatgcttcctatagttgataagcctacaatacagtatata
attgaagaagcagtacaatcaggaatagaagaaatacttgttattacaggaagaaacaaa
agagctatagaggatcattttgataaatcatttgaacttgaaagtgaacttgagagtcat
aacaaaaaagaacttcttaaggttgtaaaagatatatctaatttagctaatatatactat
atacgtcagaaggaaccaagaggccttggacatgcaattaattgtgctagaacttttgta
ggtaatgaaccatttgcagttttattaggtgatgatgtagtaaatgcaaaggtaccatgc
ttaaagcaacttataaattgttataatgagtataaaacttccatattaggagttcaaagg
gtgcctaattcagaggtgtcaaaatatggtatagtaaatggcatgcatatagaagatgga
gtttataaggtaaaggatttggttgaaaagccaaaacaagaagaagcaccttccgattta
gctatactaggaagatacataataactccatctatatttgatatattagataacactaaa
ccaggtaagggtgatgaaattcaacttacagatgcacttaaaacacttatgaaaacagaa
gcaatgtacgcttatgtattctcaggaagacgatatgatgttggagataaattaggtttc
cttcaagctacagttgagtatgcattaaagagagaagagcttaaaaaaccatttatgaac
tatttatttactataaaagataatcctaattttaaatctttatatgacgaattaaacaaa
aagagtaaatag

DBGET integrated database retrieval system