KEGG   Clostridium acetobutylicum DSM 1731: SMB_G2689Help
Entry
SMB_G2689         CDS       T01548                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cae00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cae00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2768141..2769064)
Genome map
AA seq 307 aa AA seqDB search
MLKGRSLIDPMDFTVDELEEIFKLADDIIACPKEYMHAAEGKILATLFYEPSTRTRFSFE
TAMLRLGGQVVGFSEPNSSSVSKGETIADTIRVVSCYADIAAMRHPKEGAPKVASMYSSI
PVINAGDGGHQHPTQTLTDLLTMRRTKKRLSNLTIGMCGDLKFGRTVHSLIKAMSRYDNN
KIVLISPDELKVPEYIKKEILDKNNIEYKEAKRIEDVIEELDVLYMTRVQKERFFNEEDY
IRLKDSYILNENKLKTAKKDMIILHPLPRVNEISYEVDNDERAYYFKQAKNGMYVRMALM
AKLMGVL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaggtagaagtttaattgatcctatggatttcactgtagatgagctggaagaa
atatttaaacttgcagacgatataatagcgtgtcctaaggaatatatgcatgcagcagaa
ggtaaaatacttgccactttattttatgaacctagtacaaggactagatttagttttgaa
acagcaatgttaagacttggaggtcaggttgttggtttttctgagccgaactcaagttcc
gtgtcaaaaggagaaactattgcagatactataagagtagtttcttgttatgcagatatt
gcagcgatgaggcatcctaaagaaggtgctccaaaggtcgcttccatgtattcatcaatt
ccagtaataaatgcgggagatggcggacatcaacatccgactcaaaccctaacagatcta
ttaacaatgagaagaacaaaaaagagactttcaaatttgaccataggtatgtgtggagat
ttaaaatttggaagaacggtccattctttaataaaagcaatgtccagatatgataataat
aaaatagtattgatttctcctgatgagcttaaagttccagaatacataaaaaaagagata
ctcgataagaacaatatagaatataaagaggctaaaagaatcgaggatgttattgaagaa
ttagatgtgctctatatgacaagagtacaaaaggaaagattttttaatgaggaagattat
ataaggcttaaagatagctatatacttaacgaaaataaattaaaaactgcaaaaaaagat
atgataatacttcatccgcttcctagagtcaatgaaatttcatatgaagtagataatgat
gaaagggcatactattttaaacaggcaaagaacggaatgtatgtcagaatggctcttatg
gcaaaattaatgggggtgttataa

DBGET integrated database retrieval system