KEGG   Clostridium acetobutylicum DSM 1731: SMB_G2758Help
Entry
SMB_G2758         CDS       T01548                                 

Gene name
ytjP
Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMB_G2758 (ytjP)
  Amino acid metabolism
   00300 Lysine biosynthesis
    SMB_G2758 (ytjP)
Enzymes [BR:cae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SMB_G2758 (ytjP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2849943..2851340)
Genome map
AA seq 465 aa AA seqDB search
MDKINEKIDLLKDDMVSSIQEILRIKSISGEAEGNAPFGKDTAKALDYALKLAERLGFKT
VNLDNYVGYAEYGEGEDYVAVLGHLDVVPEGDGWNYPPYAAEIHDGKLYARGSMDDKGPT
VACLYSLKAIVDAGLTMSKKVRIIFGLDEETGSGKDTEHYLKNEKPPVLGFTPDAEYPII
NGEKGITIFNLVKDFKNDYEGDTKIIYVKGGERSNVVPPYAEAGIRADLKGEIIDKCESF
AERTGYDIKAEEKDDMVIVKSKGIAAHGSMPELGKNAIMQLLAFLEELNLGKSDFNDYIA
FLNRYVGMETNGESFGIGMEDKVSGKLSFNLGIIDFNKDQGKVVLNVRYPVTCKYEDMMD
GINARIADTGIRVENMTHQKSLYFPEDHELVKLLQKVYKEQTSEEPKLLSIGGGTYAKEM
PNIVAFGPIFPGEPDVDHQANEFIKIEHLILNAKIYAHAIYELAR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggataagataaacgagaagatagacttattaaaggatgatatggtttcttcaattcaa
gaaatccttagaattaaaagtatcagcggggaagctgaaggaaatgcaccatttggaaag
gatacagcaaaggcacttgactatgctttaaagttagctgaaagacttggtttcaaaact
gttaatttagataactatgttggatatgctgaatatggtgaaggagaagattatgtagca
gtacttggtcaccttgatgtagtgccagaaggagatggatggaattatcctccatatgct
gcagaaatacatgatggaaagctatatgcaagaggatcaatggatgacaagggacctaca
gtagcatgtttatattcattaaaggctattgtggatgcaggacttactatgtctaaaaaa
gttagaattatattcggtttggatgaggaaactggttcaggaaaagatacagagcattat
ttaaagaatgaaaaaccaccagttcttggctttactccagatgctgaatatccaataatc
aatggagaaaaaggaataacaatttttaacttagtaaaagattttaaaaatgattacgaa
ggagatacaaagattatttatgtaaaaggaggagaaagatcaaatgtagttcctccatac
gctgaagctggaataagagcagatttaaagggcgaaatcattgataaatgtgaaagtttc
gctgaaagaactggatatgatataaaagctgaagaaaaagacgatatggttatagtaaaa
tcaaaaggaattgctgcacatggaagtatgccggagcttggaaaaaatgctataatgcag
cttttagcttttctagaagaattaaatcttggaaaatctgattttaatgattatatagct
ttcttaaatagatatgttggaatggaaactaacggagaatcttttggaattggtatggaa
gataaggtttcgggtaagctttccttcaatcttggaataatagactttaataaagaccaa
ggaaaagttgttcttaatgttagatatcctgtaacttgcaaatacgaggatatgatggat
ggaataaatgctaggatagctgatactggaataagagttgaaaacatgacacaccagaag
tcattatactttccagaagatcatgaattagtaaaacttcttcaaaaagtatataaagag
caaactagtgaggagccaaaacttctttcaataggcggaggaacttatgcaaaggaaatg
cctaacatagtagcctttggaccaatattcccaggagaaccagatgttgatcaccaagca
aatgaatttataaaaattgaacatttaatactaaatgcaaaaatatatgctcatgcaata
tatgagcttgctcgttaa

DBGET integrated database retrieval system