KEGG   Clostridium acetobutylicum DSM 1731: SMB_G2776Help
Entry
SMB_G2776         CDS       T01548                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMB_G2776 (gpmA)
   01230 Biosynthesis of amino acids
    SMB_G2776 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMB_G2776 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SMB_G2776 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMB_G2776 (gpmA)
Enzymes [BR:cae01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SMB_G2776 (gpmA)
Exosome [BR:cae04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SMB_G2776 (gpmA)
  Exosomal proteins of melanoma cells
   SMB_G2776 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
2870829..2871560
Genome map
AA seq 243 aa AA seqDB search
MRKLVLLRHGQSEWNKENRFTGWTDVDLSVDGVSEAAQAGRILKKNNYTFDAAYTSVLKR
AIRTLQIVLYEMDLLWIPVYKSWKLNERHYGALQGLNKDETRDKYGEDQVHLWRRSVEVR
PPALEKSDKRYPGNEKKYASLKEEELPVTENLEDTEKRVLQDWRELIAPNIKGGKNIIIS
AHGNTLRALVKYLDNIPSDGIANLNIPTGTPLVYELDENLEPITRYYLGMDGKIEDDKFP
KKV
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaaacttgtgttattaagacacggtcaaagcgaatggaacaaagaaaacagattt
actggctggactgatgttgatttatctgtagatggagttagcgaagccgctcaagcagga
agaatactgaaaaaaaataactatacctttgatgctgcttatacttcagtgcttaaaaga
gccataagaacacttcaaatagttctatatgaaatggaccttctatggatacccgtctat
aaatcctggaaattaaacgaaagacattatggtgcacttcaaggactaaacaaagatgaa
actagagataaatatggagaagatcaagttcatctttggaggcgttctgttgaggtaaga
ccgcctgctttagaaaaatctgataaaagataccccggtaatgaaaaaaaatatgcttcg
ttaaaggaagaagaattgcctgttactgaaaatctagaagatacagaaaaaagggtttta
caggactggcgtgaattaatagctcctaatataaagggaggtaagaatattataatttct
gctcatggaaatactctaagagctcttgtaaaataccttgacaacataccaagcgatgga
atagcaaatttaaatattcctactggaacccctttagtctatgagcttgatgaaaatttg
gaaccaataacacgctattacttaggtatggatggaaaaatagaggatgataaattccct
aaaaaagtttaa

DBGET integrated database retrieval system