KEGG   Clostridium acetobutylicum DSM 1731: SMB_G2923Help
Entry
SMB_G2923         CDS       T01548                                 

Gene name
tdk
Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cae00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SMB_G2923 (tdk)
Enzymes [BR:cae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SMB_G2923 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3020074..3020661)
Genome map
AA seq 195 aa AA seqDB search
MYRPKDHGWVEVIVGPMYSGKSEELIRRIRRAKIAKQKIQVFKPEIDNRYSKEDVVSHMG
EKEQAVAIKNSREILKYFEEDTEVIAIDEVQFFDDEIVEIVNKIAESGRRVICAGLDMDF
RGKPFGPIPELMAIAEFVDKIQAICVVCGNPATRTQRLINGKPAFYDDPVVLIGAMESYE
ARCRKCHVVPQKKEV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtacagaccaaaggaccacggatgggttgaggttattgtaggaccaatgtatagtggg
aaatcagaagaacttataagaagaataagaagagctaaaattgcaaaacaaaaaattcaa
gtttttaaacctgaaatagataacagatatagtaaagaagatgtagtttctcatatggga
gagaaggaacaggcagttgcaattaaaaatagtagagaaatattaaaatattttgaggag
gatacagaggtaattgcaatcgatgaggtacagttttttgacgatgaaatagtagaaatt
gtaaataaaattgcggagagtggtagaagagtaatttgcgctggacttgatatggatttt
agaggtaagccatttggacctataccagagcttatggctattgcagaatttgtagacaag
attcaggcaatatgcgttgtatgtggaaatccagcaactagaacgcagaggttaataaat
ggaaagccagcgttttatgatgatccggtggttttgataggagcaatggagtcttatgaa
gcaagatgtaggaaatgccatgttgttccacaaaaaaaagaggtgtaa

DBGET integrated database retrieval system