KEGG   Clostridium acetobutylicum DSM 1731: SMB_G2962Help
Entry
SMB_G2962         CDS       T01548                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SMB_G2962 (folP)
Enzymes [BR:cae01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SMB_G2962 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3060487..3061293
Genome map
AA seq 268 aa AA seqDB search
MKIANKDFILGERTYIMGILNVTPDSFSDGGKFNNLDNALKHAAKLIEDGADIIDIGGES
TRPNHSSVDKNEELERVIPIIEAVSHEFDIPISIDTYKGEVAEAALESGAHLINDVWGFK
KDTYMAKVAAKYDVPCCLMHNRENNDYSNFLQDVIDDLKESIDIAINAGVKPENIMIDPG
IGFAKDFNQNLLLMNNLEKLNVLNFPILLGTSRKSMIGNILNLPPNKRVEGTVATSVIGV
VKGCDFIRVHDVLENKRACMVADAIIRR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcgaataaagattttatacttggagaaagaacttacataatgggaatttta
aatgttacacctgattctttttctgatggaggaaaatttaataatttagacaatgcttta
aaacatgcagctaagctcatagaagatggcgctgatataattgatatcggtggtgaatcc
acaagaccaaaccactcttctgttgacaaaaatgaggaactagaacgggttattccaata
atagaagccgtatcgcacgaatttgatattccaatttctatagatacctataagggcgaa
gttgcagaggccgcattagaatctggtgcgcaccttataaatgatgtatggggtttcaaa
aaagatacatatatggctaaggtagctgcgaaatatgatgttccttgttgtctaatgcat
aatagagaaaataacgattatagtaactttcttcaagatgttatagatgatttaaaagaa
agtatagatatagcaataaatgctggtgttaaaccagaaaatataatgatagatcctgga
ataggttttgcaaaagacttcaatcaaaatttgcttttaatgaataatttagaaaaatta
aatgttttaaatttccctattcttttgggcacttctagaaaatcaatgataggcaatatt
ttaaatttgcctcccaacaaaagagttgagggtacagttgctacttcagtcataggtgta
gtcaaaggctgtgattttattagagttcatgacgttcttgaaaataaacgagcttgtatg
gtagctgatgcaataataaggagatga

DBGET integrated database retrieval system