KEGG   Clostridium acetobutylicum DSM 1731: SMB_G2962Help
Entry
SMB_G2962         CDS       T01548                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cae00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3060487..3061293
Genome map
AA seq 268 aa AA seqDB search
MKIANKDFILGERTYIMGILNVTPDSFSDGGKFNNLDNALKHAAKLIEDGADIIDIGGES
TRPNHSSVDKNEELERVIPIIEAVSHEFDIPISIDTYKGEVAEAALESGAHLINDVWGFK
KDTYMAKVAAKYDVPCCLMHNRENNDYSNFLQDVIDDLKESIDIAINAGVKPENIMIDPG
IGFAKDFNQNLLLMNNLEKLNVLNFPILLGTSRKSMIGNILNLPPNKRVEGTVATSVIGV
VKGCDFIRVHDVLENKRACMVADAIIRR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcgaataaagattttatacttggagaaagaacttacataatgggaatttta
aatgttacacctgattctttttctgatggaggaaaatttaataatttagacaatgcttta
aaacatgcagctaagctcatagaagatggcgctgatataattgatatcggtggtgaatcc
acaagaccaaaccactcttctgttgacaaaaatgaggaactagaacgggttattccaata
atagaagccgtatcgcacgaatttgatattccaatttctatagatacctataagggcgaa
gttgcagaggccgcattagaatctggtgcgcaccttataaatgatgtatggggtttcaaa
aaagatacatatatggctaaggtagctgcgaaatatgatgttccttgttgtctaatgcat
aatagagaaaataacgattatagtaactttcttcaagatgttatagatgatttaaaagaa
agtatagatatagcaataaatgctggtgttaaaccagaaaatataatgatagatcctgga
ataggttttgcaaaagacttcaatcaaaatttgcttttaatgaataatttagaaaaatta
aatgttttaaatttccctattcttttgggcacttctagaaaatcaatgataggcaatatt
ttaaatttgcctcccaacaaaagagttgagggtacagttgctacttcagtcataggtgta
gtcaaaggctgtgattttattagagttcatgacgttcttgaaaataaacgagcttgtatg
gtagctgatgcaataataaggagatga

DBGET integrated database retrieval system