KEGG   Clostridium acetobutylicum DSM 1731: SMB_G3194Help
Entry
SMB_G3194         CDS       T01548                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
cae00260  Glycine, serine and threonine metabolism
cae00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cae01100  Metabolic pathways
cae01110  Biosynthesis of secondary metabolites
cae01130  Biosynthesis of antibiotics
cae01230  Biosynthesis of amino acids
Module
cae_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cae00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMB_G3194 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMB_G3194 (trpB)
Enzymes [BR:cae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SMB_G3194 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEI33744
Position
complement(3294497..3295681)
Genome map
AA seq 394 aa AA seqDB search
MNGRFGKFGGQYVPETLMNAINELEVEFNKAINDEKFMMEYKYYLEKYVGRETPLYFAEN
MTKNLGGAKIYLKREDLNHTGSHKLNNALGQVLLAKRMGKKRVIAETGAGQHGVATATAA
ALFGLECEVFMGAEDVERQALNVFRMKILGAKVNSVKSGTNTLKDAINAAMRDWVTNIDN
TYYVIGSVMGPHPYPTIVKDFQKIIGEEARKQILKAEGRLPDYVVACVGGGSNSMGIFYP
FIKDEGVKLIGVEAAGLGIDTPMHAATLTKGSVGIIHGMMTYVLQDEDGQITPAYSVSAG
LDYPGVGPQHSYLKEKERASYEAVTDKEALKAFLYLSEKEGIIPALESSHAVAYAMKLAP
SLSKDEIVIINLSGRGDKDVNTVMKNMEENKNGK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaagatttggaaaatttggaggacagtatgttccagagacattaatgaatgca
ataaatgaacttgaggttgaatttaataaggcaataaatgatgaaaaatttatgatggaa
tacaagtattatcttgaaaaatatgttggaagagaaacaccactatattttgctgaaaac
atgacaaagaatcttggtggagcaaaaatatatctaaaaagagaggatttaaatcataca
ggttcccataagttaaataatgctttaggacaagtacttttggcaaagagaatgggaaaa
aagagagtcatagcagaaacaggagcaggacagcatggagttgctacggctacagcagca
gctttgtttggattagaatgtgaagtgtttatgggagcagaagatgttgaaaggcaagcg
cttaatgtgtttagaatgaagatattaggagcaaaagtgaattcagtaaaatcgggcact
aatactttaaaggatgcaataaacgcagctatgagagattgggttacgaatatagacaat
acttactatgtaataggttcagtaatgggtccgcatccgtatccaactatagtaaaagac
tttcaaaagattataggagaagaggctagaaagcagatattaaaagcagaaggaagactt
ccagactatgttgttgcatgtgtaggagggggaagtaactccatgggtatattttatcct
tttattaaggatgaaggagtgaagcttataggtgttgaagcagctgggctcgggattgat
actccaatgcatgcggcaacgcttacaaaaggaagtgtaggtataatacatggaatgatg
acttatgtgcttcaagacgaagatggtcaaataactccagcatattcagtatctgcgggg
cttgattatccaggagtgggaccacagcattcttacttaaaggaaaaagaaagagcaagc
tatgaggctgtaactgataaagaagccttaaaggcgtttttgtatttatcggaaaaggaa
ggaataatacctgcgcttgagagttctcatgcagtagcctatgctatgaaactggcacct
agcctatcaaaagatgagattgttattataaatctttctggaagaggagataaggatgta
aatactgtaatgaaaaatatggaggaaaataaaaatggcaaataa

DBGET integrated database retrieval system