KEGG   Clostridium acetobutylicum DSM 1731: SMB_G3194Help
Entry
SMB_G3194         CDS       T01548                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMB_G3194 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMB_G3194 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMB_G3194 (trpB)
Enzymes [BR:cae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SMB_G3194 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3294497..3295681)
Genome map
AA seq 394 aa AA seqDB search
MNGRFGKFGGQYVPETLMNAINELEVEFNKAINDEKFMMEYKYYLEKYVGRETPLYFAEN
MTKNLGGAKIYLKREDLNHTGSHKLNNALGQVLLAKRMGKKRVIAETGAGQHGVATATAA
ALFGLECEVFMGAEDVERQALNVFRMKILGAKVNSVKSGTNTLKDAINAAMRDWVTNIDN
TYYVIGSVMGPHPYPTIVKDFQKIIGEEARKQILKAEGRLPDYVVACVGGGSNSMGIFYP
FIKDEGVKLIGVEAAGLGIDTPMHAATLTKGSVGIIHGMMTYVLQDEDGQITPAYSVSAG
LDYPGVGPQHSYLKEKERASYEAVTDKEALKAFLYLSEKEGIIPALESSHAVAYAMKLAP
SLSKDEIVIINLSGRGDKDVNTVMKNMEENKNGK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaagatttggaaaatttggaggacagtatgttccagagacattaatgaatgca
ataaatgaacttgaggttgaatttaataaggcaataaatgatgaaaaatttatgatggaa
tacaagtattatcttgaaaaatatgttggaagagaaacaccactatattttgctgaaaac
atgacaaagaatcttggtggagcaaaaatatatctaaaaagagaggatttaaatcataca
ggttcccataagttaaataatgctttaggacaagtacttttggcaaagagaatgggaaaa
aagagagtcatagcagaaacaggagcaggacagcatggagttgctacggctacagcagca
gctttgtttggattagaatgtgaagtgtttatgggagcagaagatgttgaaaggcaagcg
cttaatgtgtttagaatgaagatattaggagcaaaagtgaattcagtaaaatcgggcact
aatactttaaaggatgcaataaacgcagctatgagagattgggttacgaatatagacaat
acttactatgtaataggttcagtaatgggtccgcatccgtatccaactatagtaaaagac
tttcaaaagattataggagaagaggctagaaagcagatattaaaagcagaaggaagactt
ccagactatgttgttgcatgtgtaggagggggaagtaactccatgggtatattttatcct
tttattaaggatgaaggagtgaagcttataggtgttgaagcagctgggctcgggattgat
actccaatgcatgcggcaacgcttacaaaaggaagtgtaggtataatacatggaatgatg
acttatgtgcttcaagacgaagatggtcaaataactccagcatattcagtatctgcgggg
cttgattatccaggagtgggaccacagcattcttacttaaaggaaaaagaaagagcaagc
tatgaggctgtaactgataaagaagccttaaaggcgtttttgtatttatcggaaaaggaa
ggaataatacctgcgcttgagagttctcatgcagtagcctatgctatgaaactggcacct
agcctatcaaaagatgagattgttattataaatctttctggaagaggagataaggatgta
aatactgtaatgaaaaatatggaggaaaataaaaatggcaaataa

DBGET integrated database retrieval system