KEGG   Clostridium acetobutylicum DSM 1731: SMB_G3410Help
Entry
SMB_G3410         CDS       T01548                                 

Definition
(GenBank) pectin methylesterase
  KO
K01051  
pectinesterase [EC:3.1.1.11]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Pentose and glucuronate interconversions
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cae00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SMB_G3410
Enzymes [BR:cae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     SMB_G3410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(3552408..3553373)
Genome map
AA seq 321 aa AA seqDB search
MIVSKNDDGDFDTIQKAVDSVSKNNKKRVIIKVKAGVYKEKLSIRKPFISLIGEDVSSTV
ITFNDSANTLMANKERMRTFNSYTMFVDGDDFICENITVENNAGDGDLVGQAVAVYADGD
RMIFRNCRLLANQDTLFTGPLPPKPIEGNNFGGPKDGMKRRDVRQYYENCYIRGDIDFIF
GSATAVFNKCEIFSNDKNKEVNGFIAAASTPEGKEFGYVFLDCKFISDARKHTVYLGRPW
RDYAKTVFIRCFMGEHIIPEGFHNWNKANAEKESYYAEYKSYGPGAANDKRVKWAKLLND
KEVEKYSITNILKGNDDWKVI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
ttgatagtatcgaaaaatgatgatggggattttgatacaatacaaaaagcagtggacagt
gtgtctaagaacaataagaaaagggttattataaaggttaaagctggagtttacaaggaa
aaactaagtataagaaaaccttttataagtctaattggtgaagatgtaagtagcacggtc
ataacctttaatgattcagctaataccttgatggctaataaagagagaatgagaactttt
aactcctatacaatgtttgtggatggcgatgattttatttgtgaaaatataactgtagaa
aataatgcaggagacggagatctagtaggacaagcagttgcggtttatgctgatggcgat
agaatgatttttagaaactgtagattattagcaaaccaagataccctatttacaggacca
cttcctccaaagcctatagagggaaacaattttggtgggccaaaggacggtatgaaaaga
agagatgtaaggcagtattatgaaaattgttatataagaggagatatagactttatattt
ggttccgccactgctgtattcaataaatgtgagattttttctaatgataaaaataaagag
gttaatgggtttatagcagcagcctcaacgccagaaggaaaagaatttggatatgtattc
ttggattgcaaattcataagtgatgcaaggaagcatactgtttatttaggaagaccttgg
agagactatgcaaaaacagttttcataaggtgttttatgggagaacacatcattccagaa
ggttttcataattggaataaggcaaatgctgaaaaagaaagctactatgcagagtataaa
agctatggtccaggtgcagcaaatgataaaagagttaaatgggcgaaacttttaaatgac
aaggaagtagaaaagtattccataaccaatattcttaagggaaatgatgattggaaggtt
atttaa

DBGET integrated database retrieval system