KEGG   Clostridium acetobutylicum DSM 1731: SMB_G3410Help
Entry
SMB_G3410         CDS       T01548                                 

Definition
pectin methylesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:cae00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cae00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3552408..3553373)
Genome map
AA seq 321 aa AA seqDB search
MIVSKNDDGDFDTIQKAVDSVSKNNKKRVIIKVKAGVYKEKLSIRKPFISLIGEDVSSTV
ITFNDSANTLMANKERMRTFNSYTMFVDGDDFICENITVENNAGDGDLVGQAVAVYADGD
RMIFRNCRLLANQDTLFTGPLPPKPIEGNNFGGPKDGMKRRDVRQYYENCYIRGDIDFIF
GSATAVFNKCEIFSNDKNKEVNGFIAAASTPEGKEFGYVFLDCKFISDARKHTVYLGRPW
RDYAKTVFIRCFMGEHIIPEGFHNWNKANAEKESYYAEYKSYGPGAANDKRVKWAKLLND
KEVEKYSITNILKGNDDWKVI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
ttgatagtatcgaaaaatgatgatggggattttgatacaatacaaaaagcagtggacagt
gtgtctaagaacaataagaaaagggttattataaaggttaaagctggagtttacaaggaa
aaactaagtataagaaaaccttttataagtctaattggtgaagatgtaagtagcacggtc
ataacctttaatgattcagctaataccttgatggctaataaagagagaatgagaactttt
aactcctatacaatgtttgtggatggcgatgattttatttgtgaaaatataactgtagaa
aataatgcaggagacggagatctagtaggacaagcagttgcggtttatgctgatggcgat
agaatgatttttagaaactgtagattattagcaaaccaagataccctatttacaggacca
cttcctccaaagcctatagagggaaacaattttggtgggccaaaggacggtatgaaaaga
agagatgtaaggcagtattatgaaaattgttatataagaggagatatagactttatattt
ggttccgccactgctgtattcaataaatgtgagattttttctaatgataaaaataaagag
gttaatgggtttatagcagcagcctcaacgccagaaggaaaagaatttggatatgtattc
ttggattgcaaattcataagtgatgcaaggaagcatactgtttatttaggaagaccttgg
agagactatgcaaaaacagttttcataaggtgttttatgggagaacacatcattccagaa
ggttttcataattggaataaggcaaatgctgaaaaagaaagctactatgcagagtataaa
agctatggtccaggtgcagcaaatgataaaagagttaaatgggcgaaacttttaaatgac
aaggaagtagaaaagtattccataaccaatattcttaagggaaatgatgattggaaggtt
atttaa

DBGET integrated database retrieval system