KEGG   Clostridium acetobutylicum DSM 1731: SMB_P052Help
Entry
SMB_P052          CDS       T01548                                 

Gene name
xynb
Definition
xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cae  Clostridium acetobutylicum DSM 1731
Brite
Enzymes [BR:cae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     SMB_P052 (xynb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSMBa:complement(53626..54582)
Genome map
AA seq 318 aa AA seqDB search
MLKSKLSKICTGVLALGLALSISGVGTFKAAMSHSKFVGNIIAGSIPSNFDTYWNQVTPE
NATKWGAIEYGRGNYNWGSADLIYNYARSKNMPFKFHNLVWGSQQPTWLSNLSPQDQKSE
VSKWIAAAGQRYSGSAFVDVVNEPLHTQPSYKNALGGDGSTGYDWIVWSYQQARKAFPNS
KLLINEYGIIGDPNAAANYVKIINVLKSKGLIDGIGIQCHYFNMDNVSVGTMNYVLNMLS
NTGLPIYVSELDMTGDDSTQLARYQQKFPVLYQNPNVKGITLWGYMQGQTWNSGTYLVNS
NGTERPALKWLRSYLASH
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaatcaaaattatcaaaaatatgtacaggagtcttagctttaggtcttgccctt
tcaatttcaggtgtaggaacttttaaagctgctatgtcacatagcaaatttgtaggaaat
attatagcaggaagtattccttctaactttgatacctattggaatcaagttacaccagaa
aatgcaactaagtggggcgcaattgaatatggtcgtggcaattataactggggaagcgca
gatcttatttataattacgccagaagtaaaaacatgccattcaaatttcataatttagta
tggggaagtcagcagcctacttggttgtcaaatctttcacctcaagatcaaaaatctgaa
gtatcaaaatggattgcagccgcaggtcaaagatattctggttcagcttttgttgatgtt
gtaaatgaaccactgcatactcaaccttcttacaaaaatgctttaggcggagatggttcc
accggttatgattggattgtatggtcttatcagcaggcaagaaaagccttccctaattca
aaacttttaattaatgaatatggcataataggcgatcctaatgcagcagctaattatgtt
aaaatcataaatgttcttaaaagcaaaggtttaattgatggaataggaattcaatgtcac
tatttcaatatggataacgtttctgtaggaacaatgaactatgttttaaatatgttatct
aatacaggtttaccaatatacgtatcagaacttgatatgactggcgatgactcaactcag
cttgctagatatcaacaaaagttccctgttctatatcaaaatcctaatgtaaaaggtata
actttatggggatatatgcaaggtcaaacttggaatagtggtacttatttagttaattca
aatggtactgaacgtccagctcttaaatggttaagatcttacttagcatcacattag

DBGET integrated database retrieval system