KEGG   Clostridium acetobutylicum DSM 1731: SMB_P114Help
Entry
SMB_P114          CDS       T01548                                 

Definition
xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cae  Clostridium acetobutylicum DSM 1731
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSMBa:complement(122675..123631)
Genome map
AA seq 318 aa AA seqDB search
MLKSKLAKICTGVLALGLALSISGVGTAKAAMSHSKFVGNIIAGNVPNNFSNYWNQVTPE
NATKWGAIEYSRGNYNWGSADLIYNYARSKNMPFKFHNLVWGSQQPNWMSNLSPQDQRSE
VSKWIAAAGKRYSGSAFVDVVNEPLHTQPSYKNALGGSGSTGYDWIVWSYQQARKAFPHS
KLLINEYGIIGDPNAAANYVKIINVLKSKGLIDGIGIQCHYFNMDNVSVGTMNSVLSTLS
KTGLPIYVSELDMTGNDATQLARYQQKFPVLYQNPNVKGVTIWGYMQGQTWNSGTYLVNS
NGTERPALKWLRSYLASH
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaatcaaagttagcaaaaatatgtacaggagtcttagctttaggtcttgccctt
tcaatttcaggtgtgggaactgctaaagctgcaatgtcacacagcaaatttgtaggaaat
attatagcaggtaatgttccaaataattttagtaactactggaaccaggttacaccagaa
aatgcaactaagtggggtgcaattgaatatagtcgtggcaattataactggggaagtgca
gatcttatttataattatgccagaagtaaaaacatgccattcaaatttcataatttagta
tggggaagtcagcagcctaattggatgtcaaatctttcacctcaagatcaaagatctgaa
gtatcaaaatggattgcagctgcaggtaaaagatattctggttcagcttttgttgatgtt
gtaaatgaaccactgcacactcaaccttcttataaaaatgccttaggcggaagtggttct
actggttatgactggattgtatggtcttatcagcaggcaagaaaagccttccctcattca
aaacttttaattaatgaatatggcataataggcgatcctaatgcagcagctaattatgtt
aaaatcataaatgttcttaaaagcaaaggtttaattgatggaataggaattcaatgtcat
tacttcaatatggataacgtttctgtaggtacaatgaactctgttttaagcactttatct
aaaacaggtttaccaatatacgtatcagaacttgatatgacaggtaatgatgctactcag
cttgctagatatcaacaaaaattccctgttttatatcaaaaccctaatgtaaaaggtgta
actatatggggatatatgcaaggtcaaacttggaatagtggtacttatttagttaattca
aatggtactgaacgtccagctcttaaatggttaagatcttatttagctagtcattaa

DBGET integrated database retrieval system