KEGG   Chloroflexus aggregans: Cagg_0017Help
Entry
Cagg_0017         CDS       T00824                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cag  Chloroflexus aggregans
Pathway
cag00790  Folate biosynthesis
cag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cagg_0017
Enzymes [BR:cag01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Cagg_0017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACL22970
JGI: Cagg0017
UniProt: B8GBZ6
Position
complement(27934..28608)
Genome map
AA seq 224 aa AA seqDB search
MSTNDYHPTHDLDEDHYEHLIIPGRGKLEGMTFSSDPRIEDAVHTILTAIGEIPEREGLQ
KTPSRVAKMYAELTAGYHIDPQALINGAVFSVAYDEMVLVTNIDYYSLCEHHMLPFFGQV
HVAYIPNGKVVGLSKIPRIVEMFARRLQVQERMTVQIADFINETLEPAGVAVVAEGIHMC
GVMRGVKKANARMVTSAMRGAFREDPKTRAEFMAHVNRASSRQD
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtctactaatgactatcatccaactcacgatctcgacgaagaccactacgaacacctg
atcattcccggccgcggcaaactcgaagggatgacgttttcatcagatccacggatcgaa
gacgctgttcatacaatcctcactgcaattggtgaaatcccagagcgtgagggtttgcag
aagacgccatcacgggtggcaaagatgtacgccgagctaaccgccggttatcatatcgat
ccacaagctttgatcaacggcgccgtcttcagtgttgcctacgacgagatggtgctggtg
accaatatcgactactacagcttgtgcgagcaccatatgttgccgttctttgggcaagtt
cacgtcgcctacattcccaacggcaaagtggtcggattaagtaagattcctcggatcgtc
gagatgtttgcccgtcgcctccaagtccaggagcggatgaccgtgcaaattgccgatttc
atcaacgaaacccttgagccggcaggagtggccgtcgtggccgaggggattcatatgtgc
ggggtgatgcgaggggtcaaaaaggccaatgcccgtatggtgacctcggcgatgcgcggt
gctttccgtgaggacccgaaaactcgtgccgagtttatggcccatgtcaatcgggcaagt
agtcgccaggattag

DBGET integrated database retrieval system