KEGG   Chloroflexus aggregans: Cagg_0040Help
Entry
Cagg_0040         CDS       T00824                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cag  Chloroflexus aggregans
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:cag01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:cag00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(62561..63841)
Genome map
AA seq 426 aa AA seqDB search
MHMDRAAQIKQIADSWNTPRFAGIVRPYTAEDVYRLRGSVQIEYTLARMGAERLWDLLHT
EPYINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPANSGPQLVR
AINNALRRADQIYHSEGRNDIYWFAPIVADAEAGFGGPLNVFEIMKAYIEAGAAGVHFED
QLASEKKCGHMGGKVLIPTQAAIRNLVAARLAADVMGVPTLIIARTDANAATLLTSDIDE
RDRPFCTGERTSEGFYRVRAGLDQAIARGLAYAPYADMIWCETSEPNLEEARRFAEAIHA
QFPGKLLAYNCSPSFNWKKKLDDATIAAFQRELGAMGYKFQFVTLAGFHTLNYSMFDLAR
KYRDHGMAAYSELQQAEFAAEAFGYTATRHQREVGTGYFDEVAQVIAGGEISTTALTGST
EEEQFH
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcacatggatcgtgccgcacaaatcaaacaaattgcagacagttggaacacacctcgc
tttgccggtattgtgcgtccgtacactgccgaagatgtctatcgtttgcgtggttcggta
cagatcgaatacactctggcgcggatgggtgccgagcgcttgtgggatctgctgcacacc
gagccgtatatcaatgccttaggcgcgctgaccggtaatcaggcgatgcagcaggtgaag
gccggattgaaggcgatctacttgagcggatggcaggttgcggctgacgctaacctcgcc
ggccaaatgtaccctgaccagagcctctatccggcaaattcaggcccacaattggtacgg
gctatcaacaacgcgctacgacgcgccgatcagatttaccacagtgaaggacgcaacgat
atttactggtttgcgccgatcgttgccgatgctgaggccgggttcggtggcccgctcaat
gtcttcgagattatgaaggcgtacatcgaagccggtgcggcgggcgtacactttgaagat
cagcttgcgtccgaaaagaaatgtgggcatatgggtgggaaagtgttgatcccaacccaa
gctgcgatccgcaatttggtggctgcccgtttggccgccgatgtgatgggggtgccgacc
cttattatcgcgcgtaccgatgctaatgcggcaaccttgctgacgagcgatattgatgag
cgcgaccggcccttctgcaccggtgagcgaaccagcgaaggcttctatcgagtacgggcc
ggccttgatcaggcaattgcacgcggcttagcctatgcaccttacgccgatatgatctgg
tgcgagacgagcgagccaaacctcgaagaggcacgacgcttcgccgaggcaattcatgct
caattcccgggcaagctgctagcgtacaactgctcgccttcgttcaactggaagaagaag
ctcgacgatgcaacgattgctgcattccagcgtgagctgggcgcaatgggctacaagttc
cagtttgtgacgctggccggcttccatacgcttaactatagcatgtttgatttggcccgg
aagtatcgtgatcacggtatggcggcgtacagtgagttgcagcaagcggagtttgccgct
gaagcgttcggctacacagccacccgccatcagcgggaggtcggtaccggttacttcgac
gaggtagcgcaggtgatcgccggtggtgagatcagtaccacggcactgaccggaagcacc
gaggaagagcagttccattag

DBGET integrated database retrieval system