KEGG   Chloroflexus aggregans: Cagg_0072Help
Entry
Cagg_0072         CDS       T00824                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cag  Chloroflexus aggregans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cagg_0072
Enzymes [BR:cag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Cagg_0072
Exosome [BR:cag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cagg_0072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(100286..101782)
Genome map
AA seq 498 aa AA seqDB search
MAKYAAAIDQGTTSTRCMIFDHSGNVICYDQKEHEQIYPRPGWVEHSPDEIWERTQSVIR
GALSKGGLSASDIVAVGITNQRETTVVWNRKTGRPVYNAIVWQDTRTDQICNELAADGGQ
DRFRAKVGLPLATYFSGPKIRWILDNVPDAREAAEAGDVVFGNIDTFLTWWLTGGPNGGV
HVTDVTNASRTMLMNLETLDWDDEILSVMGIPRQMLPKIVPSSMVYGTAVGELAGVPVAG
ILGDQQAAMVGQTCFDVGEAKNTYGTGSFMLLNTGTKIVPSKSGLLTTVCYKFGDQPAVY
ALEGSIAITGALVQWLRDNLGLITTSAEVEALANLVEDNGGIYFVPAFSGLFAPYWRSDA
RGVIVGLTRYVNKGHLARAVLEATAYQTREVLDAMEQDSGVKLTALKVDGGMVYNNTLMQ
FQADILGVPVIRPKVAETTSLGAAYAAGLAVGFWSNTDEMRANWGVDHTWTPQMDEATRE
RLYRGWKKAVTRTFDWVE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtatgctgctgcaattgaccagggtacgacgagtacccgctgcatgatcttc
gatcacagtgggaatgtcatctgctacgaccaaaaagaacacgagcagatctatccccga
cccggttgggttgagcatagccccgatgagatctgggagcgtacccagagtgtgatccgc
ggagcgttgagcaagggtggtctgagcgcgagcgatattgttgcggtggggatcaccaac
cagcgcgagacgacggtggtttggaaccgcaagactggtcgccctgtgtataacgctatt
gtgtggcaagatacgcgcaccgaccagatttgcaacgaattggccgccgatggtggtcag
gatcgtttccgcgcaaaggttggtttgcccctcgccacctatttctccggccccaagatc
cgctggatccttgataatgtgcccgatgcacgtgaagctgccgaggccggcgatgtagtc
tttggtaatatcgataccttcctaacatggtggttgaccggcggacccaacggtggcgtc
cacgttaccgatgttaccaatgcttcccgcacgatgctgatgaacctcgaaacgcttgat
tgggacgacgagattctcagcgttatggggatcccgcgccagatgttgccgaagatcgtg
ccgtcgagtatggtatacggtacggctgttggtgagttggccggagtgccggtagccggt
attctcggtgatcaacaggcggcaatggtcgggcaaacctgtttcgatgtcggtgaggcg
aagaatacctatggtaccggatcgtttatgttgctcaataccggtaccaagattgtgcca
tcgaagagcggtttgctcacaaccgtctgctataagttcggcgatcagccggcggtgtat
gcgctcgaaggttcgattgccattaccggtgctcttgtgcaatggctgcgcgataacctc
ggtctgattacgacctcggctgaagttgaggcactcgccaatttggtcgaagataatggc
ggtatctacttcgtaccggccttctccggtctgtttgccccgtattggcgctccgacgca
cgtggcgtgattgttggcctgactcgttacgtcaacaaaggccaccttgcccgcgccgtg
ctcgaagcgacggcctatcaaacacgcgaggtgctcgatgcaatggagcaggactcgggt
gtgaagctgacagcactcaaggttgatggcggtatggtgtataacaatacactgatgcag
ttccaggccgatattcttggggtaccggtgatccgccccaaggtggctgaaacgacttcg
cttggtgcagcctatgccgccggtttggccgttggcttctggtcgaataccgacgagatg
cgggcaaactggggtgtcgatcatacgtggacaccgcaaatggatgaggcgacccgcgag
cgactctatcgaggctggaagaaggcagttactcgtaccttcgattgggtcgagtaa

DBGET integrated database retrieval system