KEGG   Chloroflexus aggregans: Cagg_0079Help
Entry
Cagg_0079         CDS       T00824                                 

Definition
glycoside hydrolase family protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cag  Chloroflexus aggregans
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Cagg_0079
Enzymes [BR:cag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Cagg_0079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(110523..112742)
Genome map
AA seq 739 aa AA seqDB search
MPKLTVHNQQFWLDERPLLLQAGEFHYFRTPADQWERRLSLIVQAGFNAVACYIPWLWHQ
PQPELVDLDGTSHPMRDLAGFLDLAQRMGLYVIARPGPYIMAETINEGIPPWVFERHPQI
ALINQRGETENIASYMHPDFLSCVAEWYRAVFAVLASRQITRGGPIVLVQLDNEMGMLHW
VRNSFDLNPVAMEHFAAWREAMYGADQTSNPAMLAERLRYADGAEGAQLVADYRRFYRTY
LRDYTSWMLATARAHGLEVPAVINIHGFANGGKTFPIGLSQLADVLRMPDVISAIDVYPS
QIGEGTFHQLVLVNAMTAAIQNPAQPLFSIEFQAGGNLDFSNMSSSFYDLHTRLCLSNGM
RAINHYLFFDGENDPLLSPVKRHDWGHPVRKDGTLRSHYHRYPLLSRTLVSYGEALTLAR
PETITAIGFRLDDFMTEVNQPCTQAATNIITHQREVILFDFIARGLALSHRDFTAVDLQQ
ATLDPGRMPLMWAMLDTTSDPATERKLVDYARAGGKVVIVGRLRAEGELAQALAVQITSD
PPFSPRRVQVFDIADIPASFVQTYHGELGTVFATADGLPIGFRKPIGNGEIIVLGAAFPI
IALDDLRAFTALADWAGCPAPFTLSHWADVRLSRGPNGDFLFINHYGDDPLATEIRYRGT
QLFDAHPIHLPARSGAILPLNWRIRPDLTIRYATAEVRSITEEQGQIVVTFAQPSGHVCV
EKNGITQTMQFTNGGATLP
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaactaaccgttcacaaccaacaattctggctcgatgaacgtccacttttactg
caagcgggtgaattccactacttccgcacccccgccgatcaatgggaacgccggctcagc
ctgattgtacaagccgggtttaacgcagttgcttgctacatcccgtggctctggcaccaa
ccgcaaccggagctggtcgatctggacggcacaagccatcctatgcgcgaccttgctgga
ttcctcgatctagcccaacgtatgggtctctatgtgatcgcccgtcccggcccgtacatt
atggccgaaacgatcaacgaaggcatcccgccgtgggtttttgaacgccacccgcaaatc
gcactgattaaccagcgcggcgaaaccgaaaacatcgccagctacatgcatcccgatttt
ctgagttgtgtcgctgagtggtaccgcgctgtctttgccgtgctggcatcgcgccagatc
acccgcggcggcccgatcgtgctggtgcagctcgataatgaaatgggtatgctgcactgg
gtgcgcaacagtttcgacctcaacccggtggcgatggagcatttcgctgcgtggcgagag
gcaatgtacggcgctgaccaaaccagcaatccggcgatgctagccgaacgcttgcgttac
gccgatggcgcagaaggcgcgcaactagtggccgattatcgccgtttctatcgtacctat
ttgcgcgactacacaagctggatgctggcaacggcccgcgcgcacggtcttgaggtgccg
gcggtgatcaatattcacggctttgcgaacggtggtaagaccttcccaatcggattatcg
caattggccgatgtgttacgcatgcccgacgtgatcagtgccatcgatgtctatccgagc
cagataggcgagggcacctttcaccaactggtgctggtcaacgccatgaccgctgctatc
caaaaccccgctcaaccactcttttcgattgaatttcaggccggcggcaacctcgacttt
agcaatatgtcgagttctttctacgatctccatacccgcctgtgcctatcgaacggtatg
cgcgccatcaaccactacctctttttcgatggcgaaaacgacccgctccttagtccggtc
aagcggcacgactggggccacccggtgcgcaaagatggcacattgcgcagccactaccac
cgctacccgttgctgtcgcgcaccttggtcagctacggcgaagcactcaccttggcacga
ccagaaacgataacggctatcggcttccgcttagatgattttatgaccgaggtcaaccaa
ccttgcacccaagcagcaaccaacatcatcacccatcagcgcgaggttatcctgttcgac
ttcatcgcgcgcgggttggcgctgagccatcgcgacttcaccgcggttgacctgcaacag
gccacgctcgatccgggccgcatgccgctcatgtgggccatgctcgataccaccagcgac
ccggccaccgagcgcaagctagtggactatgctcgtgctggcgggaaggtggtgatcgtt
ggccgcctgcgcgcagagggtgagctggcgcaggcgctagcggtgcagatcacgagtgac
ccgcccttctccccgcgccgggtgcaggtctttgacattgctgatattccggccagtttc
gtgcagacctaccacggcgaactcggcacggtctttgcgacggctgatggcctgccgata
ggattccgcaaaccgattggcaacggtgaaatcatcgtgctcggcgcagccttcccgatc
atcgcccttgatgatctacgcgccttcaccgcgctggcggattgggccggctgtccagcg
ccattcaccctcagccactgggccgatgtgcggctcagtcgtggcccgaacggcgacttc
ctcttcatcaaccactacggcgacgacccgctggcaaccgagatcaggtatcgcggcacg
caactcttcgatgcccacccgatccatctgccggcccgcagcggagcgatcttaccgctc
aactggcgcatacgtcccgatctcaccattcgctacgccaccgccgaagtccgatcaatc
accgaggaacaaggccagatcgtcgtcacattcgcccaaccaagcgggcatgtttgtgta
gaaaagaatggtattactcaaactatgcaattcaccaacggcggcgccaccctcccgtag

DBGET integrated database retrieval system