KEGG   Chloroflexus aggregans: Cagg_0239Help
Entry
Cagg_0239         CDS       T00824                                 

Definition
magnesium chelatase subunit H (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
cag  Chloroflexus aggregans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cag00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(299311..303120)
Genome map
AA seq 1269 aa AA seqDB search
MSQPTEFVMVLGLQQYSQDFFRRAEAEVRKEVPDFRLHIFEDRDVTARPAEVEAAIARCR
CLILSLITLNETAEVLIPMVERHDPPVVFSFEGLPEVMRLNKVGSYNLKAGKGMPKPVQN
VARLLVGGREEDALYGYVKLQKITSKLINFLPGKRLNDFRNWTNVNNYWTHRSIANAANM
FKLILREYSGMSHLRVDPVVELPNMGFAHPDAPKLFASPAEYERWEKERNRARKGAPAPL
GTVAVLSFRAHILSGADYHHKIVHALEAAGLRVLPIFVMGIESHIVVREWLSHMKVDLII
NTMGFPLVGGPAGSTKAGLTVDVARELLSKLDVPYIVAQPLFVQDEDDWRERGVGPLQST
FLYSLPEMDGAIAPVVLGGMRGSTITTVPDRLERLARIARGFVRLRKKANREKKVAIIVY
NYPPGQGKVATAALLDVPASLIAILDRLAAEGYQVGRYPRDPETFARCLEGLVSDQPLPP
GHPPVVMGISADLQDFYRWLRPVDQERINARWGAFPGDIAPLGRDKVRLAGTQIGNIFIG
VQPVIGMPGDPMRLLFDKENTPHHQYALFYRYLSESFDADAIIHLGMHGTAEWMPGLQLG
LTDRCWPDVLLGEVPNFYVYPINNPAEANIAKRRGYSTIIGHAIPPYGRAGLYRELQALQ
DLLAEYRERPASVADDDQSPEAIAIMQKIALLNLDHDLVRQPDEPFSRFASRAYAYLRDL
AATMITDRLHVLGSAPPPEEQLTLIVETLKVPRGELPGLADLFLTARHATVRYGELLSRA
RQGDAEALALRDEIEERCTDFVHQTVFGHLSPEQAAQQFGLPAGNEVQGLIQHGRALLAA
LRDNTQELDYLVRGLAGRYIPAAPGGDIIRDGVTVLPTGRNIHSLDPFRVPTDSAYERGV
RIAEALIAAHRAETGQYPETIAQVLWGLDAIKTKGESIGIVLGLIGARPVKDGQGKVGRY
ALIPLTELGRPRVDVLMTASGIFRDIFAGTMDMLDRLVREAAAADEPVEMNYIRKHVQEM
MAAGKSFDQATARIFTQAAGTYGTDVDEAIEGSAWEKREELEDLFIKRNAYAFGGRQNGE
AQPEVLRALLGTVSRVAQEIDSVEYGLTDMQHYYGYSGALKAAAERATGQRVPLNFVESF
TAETKLQTLEQTLRVEYRTKFLNPKWYEGMLRHGHNGAAEIASRFTYMLGWSATTDAVDK
WVYDEAAKTFVLDDAMRTRIEQLNPAAARNMVGRLLEANARGIWQTDEETLERLRELHAD
LEDRLEGVA
NT seq 3810 nt NT seq  +upstreamnt  +downstreamnt
atgagccagccgacagagtttgtgatggtgctcggcttgcagcagtatagtcaggatttc
ttccgtcgtgctgaggccgaggtgcgcaaagaagttcccgactttcgcttgcatatcttt
gaagatcgtgacgtgaccgcacgacctgctgaggttgaagcggcaattgcacgctgccgg
tgtttgatcctctcgctcattacgctcaacgaaaccgccgaagtcctcatcccaatggtg
gaacggcacgatccaccggttgtcttttcgtttgaggggctgccggaggtgatgcggctc
aataaggtcggctcgtacaacttgaaggccggtaaaggcatgccgaaaccggtgcaaaat
gttgcccgcttgcttgtgggtggccgtgaagaagatgccttatacggttatgtcaagtta
caaaagattacctcaaagctgatcaatttcttgcccggtaaacgcctcaacgattttcgc
aactggaccaacgtcaataactactggacgcaccgcagtatcgccaacgcggcgaatatg
tttaagctaatcttacgtgagtatagcgggatgagccatctgcgcgttgatccggtagtt
gagctgccgaatatgggttttgctcatcccgatgcgccaaagctgtttgccagcccggct
gaatatgagcgttgggaaaaagaacgtaaccgtgcccgtaaaggcgcaccggcaccgctc
gggacggtggcagtgttgtcattccgcgcccatatcctttccggggccgattaccatcac
aaaattgtgcatgcactcgaagccgccggtctgcgggtactgccgatttttgtgatgggc
atcgagagccatatcgtggtacgtgaatggcttagccacatgaaggtcgatctgattatc
aatacgatgggctttccattggttggtggtcccgccggttcgaccaaggccggtttgacg
gttgatgttgcccgcgagttgctcagtaagctcgatgtaccgtatatcgtcgcccaaccg
ctgtttgtccaggatgaagacgattggcgtgagcgcggtgtggggccattgcagagcacc
ttcctctatagcttgcccgaaatggacggtgcgattgcaccggtggtgctcggtgggatg
cgtggcagtacgatcacaacggtgccagaccgtctcgaacggctggcccgcattgcccgt
ggctttgtccgcctgcgcaagaaggccaaccgcgagaagaaggtggcgattatcgtctat
aattatccgcccggtcaaggcaaggtggcgacagcggctctgctcgatgtgccggccagc
ttgatcgccatactcgaccggttggccgccgaggggtatcaggttggtcgttatccgcgc
gatcccgagacgttcgcccgctgccttgagggtttggtgagcgatcagccactgccaccc
ggccatccgccggtggtgatggggataagcgccgatctgcaagatttctaccgctggctg
cgacccgtcgatcaagagcggatcaatgcccgttggggcgccttccctggtgacattgcc
ccgttggggcgcgataaggtgcgtttggccggtacccagatcggcaatatctttatcggt
gtgcagccggtgatcgggatgcccggcgatccgatgcggttgctgttcgataaggagaat
acgccgcaccaccagtatgcgctcttctaccgctacctcagcgaaagcttcgacgccgac
gcgatcatccatctcggtatgcacggtactgccgagtggatgcccggtttgcaactcggt
ctcaccgatcgctgctggcctgatgtgttgctcggcgaggtgcctaacttctacgtctat
ccgatcaataacccggctgaggccaatatcgccaagcggcgcggctatagcacgattatc
ggtcatgccattccgccatacggacgggccggtctttaccgcgagttgcaggccctgcaa
gacctgctggccgagtatcgcgagcgcccggcgtcggtcgccgatgatgatcaaagccct
gaagcaatcgcgattatgcagaagatcgcactgctcaatcttgaccacgatctggtgcgc
cagcccgatgagccgtttagtcggtttgcatcacgtgcctatgcctacctgcgcgatctg
gcagcgaccatgattaccgaccggttgcatgtgctgggtagcgccccaccacccgaagag
caattgaccctgatcgtcgagacgctcaaagtgccgcgcggcgaattgcccggtctcgcc
gatttgttcctcacggcacgtcatgccacggtgcgctacggtgagttgctgagtcgggca
cgacagggtgatgccgaagccttggccctgcgcgacgagattgaggagcggtgtaccgat
ttcgtccaccagaccgtctttgggcatctgtcgcctgagcaggctgcacaacagtttggc
ttgcccgccggcaatgaggtgcagggattgatccagcacggacgggcattgctggcagcg
ttacgcgataatacgcaagaactcgactatctcgtccgtggcttggccggacgctatatt
ccggcagcccccggcggcgacattatccgcgatggggtgacggtgctgcctaccggacgc
aacatccatagcctcgaccccttccgggtgccgaccgacagcgcctacgaacgcggggtg
cggatcgctgaggcgttgattgctgcgcatcgagctgaaaccggccagtaccccgaaacg
attgcccaagtgttgtgggggcttgatgcgatcaagaccaagggtgagtcgattggtatt
gtgcttggcctgatcggcgcgcgtccggtgaaggatgggcaaggcaaggtcggtcgctac
gcgctcatcccgctgaccgagctgggacgcccacgggtggatgtgctgatgaccgcctcc
ggtatcttccgcgacatcttcgccggcacgatggatatgctcgaccgattggtacgggaa
gcggcggcagccgatgagccggttgagatgaactacatccgcaagcacgtgcaagagatg
atggctgccggcaagagttttgatcaggcgacggcgcgcatcttcacgcaggcagccggt
acctacgggaccgatgtggatgaggcgattgagggcagcgcgtgggagaagcgcgaagag
ctggaggatctgttcatcaagcgcaatgcctacgcctttggcggacggcagaatggcgaa
gcgcaacctgaagtcttgcgtgccctcctcggcaccgtcagtcgtgtcgcccaagagatt
gacagtgtggagtatggcttgaccgacatgcaacactactacggctattcgggggcgctg
aaggcggcggccgagcgggcaacgggacagcgcgtgccgctcaacttcgtcgagagtttt
actgccgaaaccaagctgcaaacgcttgagcagaccttgcgggtggagtatcgcaccaag
ttccttaacccgaagtggtatgaaggcatgctgcgccacggccacaacggcgccgccgag
atcgctagccgcttcacctatatgctcggctggagcgcaacgaccgacgcggttgacaag
tgggtgtacgatgaagcggcaaagaccttcgtgctcgacgatgccatgcgcacgcggatc
gagcaactcaatccggcagcagcccgcaatatggtggggcgcttgcttgaagccaacgcg
cgtgggatctggcagaccgacgaggagacgctggagcggttacgtgagttgcatgccgat
ctcgaagaccgcctcgaaggagtagcataa

DBGET integrated database retrieval system