KEGG   Chloroflexus aggregans: Cagg_0364Help
Entry
Cagg_0364         CDS       T00824                                 

Definition
F420-dependent oxidoreductase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
cag  Chloroflexus aggregans
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:cag00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(454627..455382)
Genome map
AA seq 251 aa AA seqDB search
MQGEIRILPLRGIGEVRPGDDLAAILATAIDAVGGLLSGDVLVVTQKIVSKAEGRLVDPA
TIEPSPFAHQIARSAKKDAHYQEVVLRESKRIVKMANGVLITETHHGFVCANSGVDESNV
DGGRRLALLPVDPDASAAALRTALATRYDYAPAVIITDTFGRPWREGQVNVAIGVAGMEP
LHDFAGIADPYGYTMQATLIAVADELAAAAELVMGKIDRVPAALVRGFAYRPSETATARR
LIRDPRFDLFR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcagggtgaaatccggattctaccccttcgtggtatcggcgaggtgcggccgggtgat
gatctggcggctatcctcgccaccgctatcgatgccgttggtggcttgcttagcggtgat
gtgctggttgtgacccaaaagatcgtctcaaaggccgaaggtcgtttggtcgatccggca
acgattgagccgtcgccgttcgcacaccagattgcccgttccgccaagaaagatgctcac
tatcaagaggtggtcttgcgcgagagtaagcggatcgtcaagatggcgaacggcgtactc
attaccgaaacccaccacggcttcgtgtgcgccaacagcggcgttgatgagtcgaacgtt
gatggcgggaggcggttggcgttgctgccggttgatcctgacgccagcgctgctgcgttg
cgcaccgcgttggctacccgctacgattatgcgccggcggtgattatcaccgacaccttt
ggccggccatggcgtgaggggcaggtcaatgtggcgattggtgtggccggtatggagcca
ctacacgattttgccggtattgccgatccctacggctatacgatgcaggccaccctgatc
gccgttgccgatgaattggccgctgccgccgagttggtgatggggaagattgatcgtgtg
ccggcggcgctggttcgcggttttgcctatcgtcccagcgagacggctactgctcggcga
ttgatccgtgatccacgcttcgatctgttccgttag

DBGET integrated database retrieval system