KEGG   Chloroflexus aggregans: Cagg_0433Help
Entry
Cagg_0433         CDS       T00824                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cag  Chloroflexus aggregans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cagg_0433
Enzymes [BR:cag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Cagg_0433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
536724..538238
Genome map
AA seq 504 aa AA seqDB search
MQFQRASGILLHPSSLPGPWGIGDLGPMAYRFVDFLVAAGQSLWQVLPLGPTGYGDSPYQ
CFSAFAGNPLLISIDDLIEHNLLTVDEARAALGYLPAERVDFGSLIPAKQTLLRQSFERF
RSSRGTPLHQAYTRFCLENAEWLADYALFMAIKEAQGGGSWHNWPPDLRDRKPEALARIR
RDLAVKIDFHQYVQFLFFRQWQSLKEYANQQGVIIIGDAPIFVADDSADVWAHRDLFYVD
AQGMPTVVAGVPPDYFSTTGQRWGNPLYRWDKMAMTGYRWWVARMRQALTLYDVLRLDHF
RGFEAYWEVPASAPTAVEGRWVKGPGADLFHVLHAELGDLPIIAEDLGLITPEVEKLRLA
FGLPGMKVLHFAFGDNPNNPYLPHNYTTNYVVYTGTHDNDTTVGWFNTLDPAGRAAVLTY
LGRDEQTVDIAWDLMRLGMMSVANYVITPLQDVLRLGSEARMNMPGRLGGNWAWRFSADA
LQEELVALLRKLTYTYGRLQPAKS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttcagcgcgcaagtggtatcttgctccatccctcatcgctgcccggaccatgg
gggattggcgatttaggcccgatggcctaccggtttgtcgactttttggtagcagccggg
caatcactctggcaggtcttgccacttggcccaaccggttacggagactcaccttaccag
tgcttttcagcctttgccggcaatccacttctgatcagtattgatgacctcatcgaacac
aatctcttaaccgtcgacgaagcccgggccgcactcggttatcttccggcagaacgggtc
gatttcggttcacttattccggccaagcaaaccctacttcgtcagagttttgaacggttt
cgtagcagccgtggcacaccgctccatcaagcgtacacacgattttgcctcgagaatgca
gagtggctggcggattatgccctctttatggcgatcaaagaggcgcaaggcggtggcagt
tggcacaattggcctcccgatctgcgcgaccgcaagcccgaggcgttggcccgcattcgc
cgcgatcttgcggtgaagattgactttcaccagtacgtgcagttcctcttcttccgccaa
tggcaatctctgaaggaatatgccaatcaacaaggcgtgattattatcggcgatgcaccg
atttttgtcgccgacgatagcgctgatgtctgggcacatcgcgatctcttttacgttgat
gcgcagggaatgccaacggtggtcgccggtgtgccaccagattacttcagcaccaccggc
cagcgctgggggaacccgctctatcggtgggataaaatggccatgaccggttatcgttgg
tgggtagcacggatgcgacaggcacttacgttgtacgacgtgctgcgtcttgatcatttt
cgcggatttgaagcttattgggaagtgccggccagtgcgccgacagcagttgaggggcgg
tgggtgaaaggaccgggcgccgatctgtttcacgtcttgcatgctgagttaggtgattta
ccgattatcgccgaagaccttggtctgattacaccggaagtagaaaaactgcggctcgca
ttcgggctacccggcatgaaggtgctccattttgccttcggtgataatccgaacaaccct
tacttgccacacaactacacaacgaattatgtcgtctataccggcacccacgataatgac
acaacggtgggctggttcaacaccctcgatccggccggccgggccgccgttctcacctat
cttggccgtgatgaacagacggttgatattgcatgggatctgatgcggctggggatgatg
tccgttgccaattacgtaattacgcctttgcaagatgtgttacggctcggctcggaggca
cggatgaatatgccgggtcgcctcggcggcaattgggcgtggcggttttcggctgatgcg
ctacaggaagaactggtggcactgttgcgaaaactcacctacacctatggtcggcttcaa
ccggcaaaaagctga

DBGET integrated database retrieval system