KEGG   Chloroflexus aggregans: Cagg_0906Help
Entry
Cagg_0906         CDS       T00824                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cag  Chloroflexus aggregans
Pathway
cag00500  Starch and sucrose metabolism
cag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cagg_0906
Enzymes [BR:cag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Cagg_0906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: ACL23824
JGI: Cagg0906
UniProt: B8G5W3
Position
complement(1134614..1136122)
Genome map
AA seq 502 aa AA seqDB search
MYNRRVSGILLHPAALPGAGGIGDIGDAAYRFIDWLVVAKQRRWQIMPLGPTSYGDSPYA
GLSALAGNPLLISLEQLVRAGWLDERALTDAPGAYGDWIDYGAVIPWKMARLEWAFGGFR
AHANAEQRAAFAEFCAEHASWLDTFALFAALKEAYRGEPWNRWDTAIARREPAALAEARR
QLAERVYFQQFLQWVFFTQWTALRRYANECGVQIIGDLPIFVAFDSADVWANPDIFHLDA
EGNPTVVAGVPPDYFSPTGQRWGNPLYRWDVLAERRYDWWIERFRLLFRLVDIVRIDHFR
GFAAYWEIPAHAATATEGRWVAGPGEALFAEVRAQLGPLPIIAEDLGLITPDVDRLRRQL
GFPGMAVLQFAWGGDASSNYLPHNYTRDLVVYTGTHDNDTTVGWWSTLDEHTRQHVRNYL
GARDETIAWDFIRAALMSVADTAIIPMQDVLGLGSWARLNLPGRAEGNWAWRMRPEQLNF
DQAHHLAYLTSLYGREPLVVAE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtacaatcggcgggtgagtggtattcttctgcatcctgcggcgttaccgggcgcgggc
gggattggtgatattggcgatgcagcctatcggtttatcgattggttagtagtagcaaaa
cagcggcgttggcagatcatgccgttgggaccgacgagctacggcgattcaccgtatgcc
ggattatcggcattagccggcaatccactgctcatctcgcttgagcagctcgtccgggcg
ggttggttggacgaacgtgccctgaccgatgcaccgggggcgtatggcgattggatcgat
tacggggcagtcattccgtggaagatggcgcggcttgagtgggcgtttggcgggttccgt
gcgcacgccaatgccgaacagcgggcagcgtttgccgagttttgtgccgagcatgcgtca
tggctcgatacatttgccctctttgccgcgttgaaagaggcctaccgcggtgagccgtgg
aaccgctgggatacagccatagcccggcgtgaaccggcggcgctggccgaggcgcgtcgc
caattggccgagcgcgtgtattttcagcagtttttgcagtgggtcttctttacgcagtgg
acggcgttacgtcgctacgccaacgagtgcggtgtgcagatcatcggcgatttgcctatc
tttgttgcctttgacagtgccgatgtttgggccaaccccgatatttttcatctcgatgct
gaaggcaacccaacggtggttgccggcgtaccaccagactactttagtccaacgggtcag
cgttggggaaatccgctgtaccgctgggatgtgttagccgaacgcagatacgattggtgg
atcgaacggtttcgtctcctctttcgtctcgttgacatcgtgcggatcgatcattttcgc
gggtttgcggcgtactgggaaatcccagcgcatgctgcgacggcaacggaggggcgttgg
gtggccggccctggggaagcgttgtttgctgaagtccgtgcgcagttgggaccgttgccg
atcatcgccgaagacctgggcttgatcacacctgacgttgatcggctgcggcgacagctt
ggatttcccggtatggcggtgttgcaatttgcatggggcggtgacgccagcagcaattat
ttgccgcacaactatactcgtgatctggtcgtgtataccggtacgcacgacaacgatacc
accgtaggttggtggtcgactctcgatgagcacacacgacagcacgtgcgtaactacctc
ggtgcgcgcgatgagacgattgcgtgggatttcatcagagcagcgctgatgtcggttgct
gatacggctatcattccgatgcaagatgtgctggggttaggctcgtgggcacggctcaat
ttaccgggacgggcagagggcaactgggcatggcgaatgcggcctgagcagctcaacttc
gatcaagcgcaccatctggcgtatctgacgtcactgtacgggcgagagccgttggtagtg
gccgagtaa

DBGET integrated database retrieval system