KEGG   Chloroflexus aggregans: Cagg_0907Help
Entry
Cagg_0907         CDS       T00824                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
cag  Chloroflexus aggregans
Pathway
cag00220  Arginine biosynthesis
cag00330  Arginine and proline metabolism
cag01100  Metabolic pathways
cag01110  Biosynthesis of secondary metabolites
cag01130  Biosynthesis of antibiotics
cag01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Cagg_0907
   00330 Arginine and proline metabolism
    Cagg_0907
Enzymes [BR:cag01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Cagg_0907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACL23825
JGI: Cagg0907
UniProt: B8G5W4
Position
complement(1136240..1137148)
Genome map
AA seq 302 aa AA seqDB search
MKTDATITIIGVPLDLGAGRRGVDMGPSAIRYAGLSRRLAELGYQVIDYGNLVTPMVETI
PLPPPDARLRYLEPITEVCERLADQVAKVVRQGITPLILGGDHSLTIGSASGSARGRRLG
LLWIDAHADFNDEHTTPSGNIHGMPLAVLTGRGHPRLTGLAGRVPAFDPAHVALVAVRDL
DPLEREALRASPISVFTMHDIDRRGMAAVMEQALTVVTTAPDGFHLSFDLDVVDPRTAPG
VGTPVSGGISRREAHLAMELIAERGALQSLDVVEVNPILDERNATAELAVELVLSALGKR
IL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccgatgccactattaccattattggagtgccgcttgatctgggggcaggtcgg
cgcggggttgatatggggccgagcgcgattcgttatgccggtctcagtcgccggcttgcc
gagttaggctatcaggtgatcgattacggtaatctggtaacaccgatggtcgagaccata
ccgttgccaccacccgacgcgcgattacgctatctcgaaccgatcaccgaggtatgtgaa
cggttggccgatcaggttgctaaggtggtccggcaaggcataaccccgcttatcctcggc
ggtgatcacagtcttaccattggttcggccagtggtagcgcgcggggacgacggcttggg
ttgctgtggatcgatgcgcacgccgattttaacgatgaacatacgacaccgagcggtaat
attcacggtatgccactggccgtgctgaccggacgtgggcatccacggttgaccggattg
gccggtcgcgtgccggcgtttgatccggcccacgtcgcgttggtcgcagtacgcgatctc
gatccgcttgagcgcgaagcgctacgtgcttcgccaatttctgtcttcacaatgcacgat
attgaccggcgcgggatggcggcggtgatggaacaggcgctgacggtcgtcacgaccgct
cctgacggctttcacctcagttttgacctcgacgttgttgatccgcgtaccgcacccggt
gtcggtacgccggtgagtggcggcatttcgcgacgcgaagcgcatctggcgatggagctg
atcgctgaacgtggtgcgttgcagagcctcgatgtcgtcgaagtaaaccccattctcgat
gaacgcaatgctaccgccgagctggccgtcgaattggtgttgtcggcgttaggcaagcgg
attttgtaa

DBGET integrated database retrieval system