KEGG   Chloroflexus aggregans: Cagg_0909Help
Entry
Cagg_0909         CDS       T00824                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cag  Chloroflexus aggregans
Pathway
cag00010  Glycolysis / Gluconeogenesis
cag00260  Glycine, serine and threonine metabolism
cag00680  Methane metabolism
cag01100  Metabolic pathways
cag01110  Biosynthesis of secondary metabolites
cag01120  Microbial metabolism in diverse environments
cag01130  Biosynthesis of antibiotics
cag01200  Carbon metabolism
cag01230  Biosynthesis of amino acids
Module
cag_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cagg_0909
  Energy metabolism
   00680 Methane metabolism
    Cagg_0909
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cagg_0909
Enzymes [BR:cag01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cagg_0909
Membrane trafficking [BR:cag04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Cagg_0909
Exosome [BR:cag04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cagg_0909
  Exosomal proteins of melanoma cells
   Cagg_0909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACL23827
JGI: Cagg0909
UniProt: B8G5W6
Position
1138526..1139041
Genome map
AA seq 171 aa AA seqDB search
MLFDLFLIRHGQPVHNPTIPYHTPPGPDLSERGRAEARQVAAFLADKAVEHLLVSPFART
TQTAEVLVDALGLPVTFTRLVQEHAPGETFEHVRERVREVLAGLADSPYRRVGIVTHGSP
IRAFLLELSHDQIDLRGHVYAGGNPAPTCGVWHVKFDHQHACQFVLAFKPV
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
gtgcttttcgatctgtttcttattcgtcacggacaaccggttcacaacccgaccattcca
taccatactccaccggggccggatttgtccgaacgcggacgcgctgaagcacgacaagtc
gcagcttttctggccgataaagcggtcgaacatctcttggtctctccattcgcgcgcacg
acacaaaccgccgaggttttggtcgatgctcttggtctaccggtcacctttaccaggctg
gtacaagaacatgcccccggcgagacgtttgagcacgttcgtgagcgtgtgcgtgaggtg
ttggccgggttggccgattcgccgtaccggcgggtcggaattgtcacccacggctcgccg
atccgggcatttttacttgaactcagccacgatcagatcgatttgcgtgggcacgtttat
gccggtggtaaccccgcaccgacctgcggagtctggcatgtgaagtttgaccatcaacat
gcttgtcagtttgtcttggcatttaagccggtctga

DBGET integrated database retrieval system