KEGG   Chloroflexus aggregans: Cagg_0909Help
Entry
Cagg_0909         CDS       T00824                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cag  Chloroflexus aggregans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cagg_0909
   01230 Biosynthesis of amino acids
    Cagg_0909
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cagg_0909
  Energy metabolism
   00680 Methane metabolism
    Cagg_0909
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cagg_0909
Enzymes [BR:cag01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cagg_0909
Exosome [BR:cag04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cagg_0909
  Exosomal proteins of melanoma cells
   Cagg_0909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1138526..1139041
Genome map
AA seq 171 aa AA seqDB search
MLFDLFLIRHGQPVHNPTIPYHTPPGPDLSERGRAEARQVAAFLADKAVEHLLVSPFART
TQTAEVLVDALGLPVTFTRLVQEHAPGETFEHVRERVREVLAGLADSPYRRVGIVTHGSP
IRAFLLELSHDQIDLRGHVYAGGNPAPTCGVWHVKFDHQHACQFVLAFKPV
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
gtgcttttcgatctgtttcttattcgtcacggacaaccggttcacaacccgaccattcca
taccatactccaccggggccggatttgtccgaacgcggacgcgctgaagcacgacaagtc
gcagcttttctggccgataaagcggtcgaacatctcttggtctctccattcgcgcgcacg
acacaaaccgccgaggttttggtcgatgctcttggtctaccggtcacctttaccaggctg
gtacaagaacatgcccccggcgagacgtttgagcacgttcgtgagcgtgtgcgtgaggtg
ttggccgggttggccgattcgccgtaccggcgggtcggaattgtcacccacggctcgccg
atccgggcatttttacttgaactcagccacgatcagatcgatttgcgtgggcacgtttat
gccggtggtaaccccgcaccgacctgcggagtctggcatgtgaagtttgaccatcaacat
gcttgtcagtttgtcttggcatttaagccggtctga

DBGET integrated database retrieval system