KEGG   Chloroflexus aggregans: Cagg_1025Help
Entry
Cagg_1025         CDS       T00824                                 

Definition
peptidase M20
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cag  Chloroflexus aggregans
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cagg_1025
  Amino acid metabolism
   00300 Lysine biosynthesis
    Cagg_1025
Enzymes [BR:cag01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Cagg_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1271266..1272354
Genome map
AA seq 362 aa AA seqDB search
MSELAEELTRLTCDLIRFETIADRPDQLQAAIDYVAAYVADLPSLHIERSSAGGKPALVM
TLRPTRSPRLILNGHLDVVVGQPHQFTPEIRNGRIYGRGSQDMKGSIAVMLRLIRDLATQ
PNPPDVGFQFVTDEEIGGRHGTGRLRDEGWSCEFMLCLEPTDLGILFEHKGGMWAKLRLP
GRAAHGSRPWEGDNPIYRLARGINALAERYPPPTGPHEWRTSVTPTEIHAGAGSRNQVPA
EVFVTFDIRWTPDTTPEAIQADLAAVFPDSEFVSVMASAGLRTDPEHHEVERIANLIERH
TGQPPRFYREHFATDARYYSHLGIPAICLGPVGAGLHSAEEWVEIASLVTLYHIINDYVK
SI
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacttgccgaggaactgacccgtctgacctgtgatctcatccgatttgagacg
attgccgaccgacctgaccagttgcaggctgcaattgattatgttgccgcatacgtggcc
gatctaccgtcgttgcacattgaacggagtagcgcaggcggtaaaccggccctcgtgatg
accttacgacctacgcgatcaccacggctcatactcaacggccaccttgatgtcgtcgta
gggcaaccacatcaatttacaccagagatacgcaacggccgcatttacgggcgtggtagc
caggatatgaaaggtagtattgcggtcatgctccgcctgatccgcgatttggcaacccaa
cccaacccacccgatgttggttttcagtttgtgaccgatgaggagatcggcggccgtcac
ggcaccggtcggctgcgcgacgaaggctggagctgcgagttcatgctctgcctcgaacca
accgatctcggcattttgttcgagcacaaaggtgggatgtgggccaaactgcgcttaccc
ggtcgtgctgctcacggttcacgaccatgggaaggtgataatccaatctatcggctggcc
cgtgggatcaatgcgctggccgaacgctacccaccacccaccggcccccacgaatggcgc
acctcggtaacaccaacggaaattcacgccggtgccggttcacgcaaccaagtaccggca
gaggtgttcgttacgttcgatattcgttggacgccggatacaaccccagaagcgattcag
gccgatctcgctgctgtcttccccgatagtgagtttgtaagtgtgatggccagcgccggt
ctccgcaccgatcctgaacatcacgaagttgaacggatcgcaaacctgatcgaacgtcat
accggccaaccaccacgcttctaccgcgaacatttcgccaccgatgcgcgttactactct
caccttggcattccggccatctgtctcggtccggtgggagccgggttacattcggctgaa
gagtgggtggagattgccagtctggtcacgctctaccacatcattaacgactacgtcaaa
agtatttag

DBGET integrated database retrieval system