KEGG   Chloroflexus aggregans: Cagg_1025Help
Entry
Cagg_1025         CDS       T00824                                 

Definition
(GenBank) peptidase M20
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cag  Chloroflexus aggregans
Pathway
cag00300  Lysine biosynthesis
cag01100  Metabolic pathways
cag01120  Microbial metabolism in diverse environments
cag01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Cagg_1025
Enzymes [BR:cag01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Cagg_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: ACL23940
JGI: Cagg1025
UniProt: B8G6K3
Position
1271266..1272354
Genome map
AA seq 362 aa AA seqDB search
MSELAEELTRLTCDLIRFETIADRPDQLQAAIDYVAAYVADLPSLHIERSSAGGKPALVM
TLRPTRSPRLILNGHLDVVVGQPHQFTPEIRNGRIYGRGSQDMKGSIAVMLRLIRDLATQ
PNPPDVGFQFVTDEEIGGRHGTGRLRDEGWSCEFMLCLEPTDLGILFEHKGGMWAKLRLP
GRAAHGSRPWEGDNPIYRLARGINALAERYPPPTGPHEWRTSVTPTEIHAGAGSRNQVPA
EVFVTFDIRWTPDTTPEAIQADLAAVFPDSEFVSVMASAGLRTDPEHHEVERIANLIERH
TGQPPRFYREHFATDARYYSHLGIPAICLGPVGAGLHSAEEWVEIASLVTLYHIINDYVK
SI
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacttgccgaggaactgacccgtctgacctgtgatctcatccgatttgagacg
attgccgaccgacctgaccagttgcaggctgcaattgattatgttgccgcatacgtggcc
gatctaccgtcgttgcacattgaacggagtagcgcaggcggtaaaccggccctcgtgatg
accttacgacctacgcgatcaccacggctcatactcaacggccaccttgatgtcgtcgta
gggcaaccacatcaatttacaccagagatacgcaacggccgcatttacgggcgtggtagc
caggatatgaaaggtagtattgcggtcatgctccgcctgatccgcgatttggcaacccaa
cccaacccacccgatgttggttttcagtttgtgaccgatgaggagatcggcggccgtcac
ggcaccggtcggctgcgcgacgaaggctggagctgcgagttcatgctctgcctcgaacca
accgatctcggcattttgttcgagcacaaaggtgggatgtgggccaaactgcgcttaccc
ggtcgtgctgctcacggttcacgaccatgggaaggtgataatccaatctatcggctggcc
cgtgggatcaatgcgctggccgaacgctacccaccacccaccggcccccacgaatggcgc
acctcggtaacaccaacggaaattcacgccggtgccggttcacgcaaccaagtaccggca
gaggtgttcgttacgttcgatattcgttggacgccggatacaaccccagaagcgattcag
gccgatctcgctgctgtcttccccgatagtgagtttgtaagtgtgatggccagcgccggt
ctccgcaccgatcctgaacatcacgaagttgaacggatcgcaaacctgatcgaacgtcat
accggccaaccaccacgcttctaccgcgaacatttcgccaccgatgcgcgttactactct
caccttggcattccggccatctgtctcggtccggtgggagccgggttacattcggctgaa
gagtgggtggagattgccagtctggtcacgctctaccacatcattaacgactacgtcaaa
agtatttag

DBGET integrated database retrieval system