KEGG   Chloroflexus aggregans: Cagg_1166Help
Entry
Cagg_1166         CDS       T00824                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cag  Chloroflexus aggregans
Pathway
cag00030  Pentose phosphate pathway
cag01100  Metabolic pathways
cag01120  Microbial metabolism in diverse environments
cag01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cagg_1166
Enzymes [BR:cag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Cagg_1166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ACL24076
JGI: Cagg1166
UniProt: B8G7B9
Position
complement(1436425..1438254)
Genome map
AA seq 609 aa AA seqDB search
MALGGYANRVAHVDLTAGTVEYRGIPEDWARKYVGARGLGVRYMLENGPQVDPLSPDNLL
CFMNGPLTGTEANMSGRMAIVTKSPLTGTVTDSHHGGWSAARLRWAGFDGLVVKGKASSP
VYLYVHDGIVEIMDASEVWGKGIHDTVKFFRERYGEKDLSVIAIGPAGENLVKFACWVNE
NDRASGRGGTGCVGGSKLLKAVVIKSAKQMPKAANLDAWKPAHKRALATIMDERNITSPR
KGGLSVYGTNVLMNITSAMGALPTKNSMVTSFGPNAEKISGEYVKEHILVNDPTCHACPV
ACKKEVEIKEGPWKGLRMESVEYEPAWSLGANCGNDDINTVAKLIDMCNDYGMDAIELGH
PLSVYMEATERGYTNGADGLAWGDTMAMVEMARKIAMREGIGNVMADGTEATARYFGHPE
LAMTVKGQGVPAYDPRGLKGMGIAYATSNRGACHLRAYTPAAELGVMPFGSLKVDPLAWK
GKGELVKIFQDVHAFSDSLDLCKFSAFAESPEEYAAQYAAMVGVECTPEDVLKIGERIYN
LERYYNNLAGFREGSDYLPARFTQEPSTMPGSEGHVCELDEMLAEYYAARGWVNGVVPES
KLRELGIID
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggctcttggcgggtacgcaaaccgagtcgcccatgtcgatctgacggctggaacggtg
gaatatcgcggcattcccgaagactgggcgcgcaagtatgttggcgcgcgtgggcttggg
gtgcgctatatgctcgagaatggcccgcaggttgatccactctcgcccgataacctgctc
tgctttatgaacggcccgctgactggcactgaagcgaatatgagcgggcggatggcgatc
gtgactaagtcgcccctgaccggcaccgtcaccgatagccatcacggcggttggtcggcg
gcgcggctgcgctgggccggctttgacggcctggtggtgaagggcaaggccagcagcccg
gtctacctatacgtgcatgatggcatcgtcgagattatggatgcctcggaggtctggggc
aaaggcattcacgatacggtcaagttcttccgcgagcgctacggcgagaaggatctgagc
gtgatcgcgatcggccccgccggtgagaatctggtcaagtttgcctgctgggtcaacgag
aacgaccgcgccagcgggcgcggcggcaccggctgcgtcggcggcagcaagttgctcaag
gcggtggtgatcaagtcagccaaacagatgcccaaggcggccaacctcgatgcgtggaag
ccggcccacaagcgcgccctcgccacgatcatggatgagcgcaacatcacgagcccgcgt
aagggtggtctctcggtctacggcaccaatgtattgatgaacattactagcgcaatgggg
gcgttgcccactaagaacagcatggtcacctcgtttggccccaacgccgagaagattagc
ggtgagtatgtcaaggagcatattctggtcaatgacccgacctgtcacgcttgcccggtg
gcctgtaagaaagaggtcgagatcaaagaggggccgtggaagggtctccgcatggagagc
gtcgagtacgagccggcgtggtcgctcggtgcgaactgcggcaacgatgatattaacacc
gtcgccaagctgatcgatatgtgcaacgactacggtatggacgccatcgagctgggccat
ccgctttcggtgtacatggaagcgaccgagcgtggctataccaacggcgctgacggcttg
gcgtggggcgacacgatggcgatggtcgagatggcgcgcaagattgctatgcgcgagggg
atcggcaatgtgatggccgatggcaccgaggcaacggcgcggtattttggccaccccgaa
ttggcgatgacggtgaagggccaaggcgtgccggcctacgatccacgtggtctgaagggt
atgggcattgcctacgcgaccagcaaccgcggcgcctgccacctgcgcgcctataccccc
gccgctgagctaggggtgatgccgttcggctcgctcaaggtcgatccgctggcgtggaag
ggcaagggtgagctggtgaagatcttccaagatgttcacgccttctccgacagcctcgat
ctgtgcaagttcagcgccttcgccgaaagccccgaggagtacgcggcccagtatgcggcg
atggtcggggttgagtgtacgccggaagatgtgctcaagatcggcgagcgcatctacaac
ctcgagcgctactacaacaatctggccggtttccgcgagggcagcgactatttgccggct
cgcttcacccaagagccgtcaactatgcccggttcggaaggccacgtctgcgagcttgat
gagatgctggccgagtactacgcggcccgcggttgggtgaatggcgtggtgccggagagc
aagctgcgcgagctggggattatcgattaa

DBGET integrated database retrieval system