KEGG   Chloroflexus aggregans: Cagg_1174Help
Entry
Cagg_1174         CDS       T00824                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cag  Chloroflexus aggregans
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Cagg_1174
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Cagg_1174
   00650 Butanoate metabolism
    Cagg_1174
  Lipid metabolism
   00071 Fatty acid degradation
    Cagg_1174
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cagg_1174
   00310 Lysine degradation
    Cagg_1174
   00360 Phenylalanine metabolism
    Cagg_1174
   00380 Tryptophan metabolism
    Cagg_1174
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cagg_1174
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Cagg_1174
   00281 Geraniol degradation
    Cagg_1174
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Cagg_1174
   00627 Aminobenzoate degradation
    Cagg_1174
   00930 Caprolactam degradation
    Cagg_1174
Enzymes [BR:cag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Cagg_1174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1447445..1448221
Genome map
AA seq 258 aa AA seqDB search
MSDETLVLSTIEGPVAILTLNRPQALNALSPALIDALIRHLEHCDNDDTIRVIIITGAGR
AFAAGADIKAMADATPIDMLTTDMIARWARIAAVRKPVIAAVNGFALGGGCELAMMCDII
LASETAQFGQPEINIGIIPGAGGTQRLTRAIGPYRAMEMVLTGATISAQEAYAYGLVNRV
CPPDSLLDEARRLAQTIAAKPPLAVRLAKEAVRAAAETTVREGLAIELRNFYLLFASADQ
KEGMRAFIEKRTANFSGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgaaacgcttgtgctcagcactatcgaaggccccgttgcaatccttacgctc
aatcgaccacaagcactcaatgcccttagccctgccctcatcgacgcactcatccgccat
cttgagcattgcgataacgacgatacgatccgggtgatcattatcaccggcgccggtcgc
gcctttgccgccggcgccgacatcaaggcgatggccgatgcgacgccgatcgatatgctt
acaaccgatatgattgcccgctgggcgcggattgcggcggtgcgcaaacccgtgatcgca
gccgtgaacggatttgccctcggtggtggctgcgagttggctatgatgtgtgacatcatt
cttgccagtgaaacagcccaattcggtcaacccgaaatcaacatcggcattatccccggc
gccggtggcacccaacgcctgacccgcgcaattggcccataccgtgcaatggagatggtc
ttaaccggtgctaccatcagtgcccaagaagcttacgcctacggcctggtgaatcgggta
tgcccacccgatagcctgcttgatgaagcccgccggttggcccagaccattgcagccaag
ccgccgctcgctgtgcgtttagccaaggaagccgtgcgcgctgcggctgaaacgaccgtg
cgtgaagggttagccattgaattgcgtaacttttatctgctctttgccagtgccgatcag
aaagagggcatgcgagcctttatcgaaaagcgtacagccaacttcagtggtcgctaa

DBGET integrated database retrieval system